*IsWdbtld /LOONfЏe   xЏU  | p 8ЏE H <0 HO%   0O  x O P D Ol      ɟ Q)A h), \) P) T)00   0 0) 4) T P0\ l^ P M@J`@LHTD?F;P 4 1*t.|h6Q`00L=`H0(2S`100,`! ֟w 'b X    f2 0WAKxElxpv`^@         U  1          J  U  3  P  %  % $ $ $ ( $ $  1 @x40D |D@@!00000000H4 @4$D@@\4 X40!@P`p3Q pP 3 30# #  !`p4Q pP/   0@### @0## # ####  Q00P   1000/    P/**/>?  0123456789ABCDEFSTKP??@MTSTMBK2ENDMPRE$PST$PREZPSTZFLSHUNDFSWI PABTDABTIRQ FIQNUSDDRAM ERRORWKUPSKWUddedeTUrUrUTEEr 0040Q40KK$!"JJrCq EE`4 -L( $141@T  14&Nx0\40@ 0 9 Q000; >0@  01 Pp0@p  01 PX04v4800 @008<@DH  ?L 0-L† @\*l0P \ , ; 01. ;01ƌ\: 00 000H -L, *$0001#::xH 0-L MԠ P 303038@K430P343343`03X03P03H03@03803003 ,PTX\`dhlpt0 -L 0x -Lh @T 3L0~3D0{3<0x3T t3$0q30n3| -L4 'lHDHPX%XER 2V32S31P31M31J31G3DV iV 91?3T/1:3U 1U !111-3T T d1%3\1U <U T1D1H13)U813 ,1V31Q3 1L31U8S 0000020,30'30202|02Txt   -L4 000 00002 00 0-LT @H0P 0S 40  }v00000< -LX T0P0 0R000(00 000 -LMl000 20`3c12c R*80`3c12c#00lS000 0S: p-L @`0,u0P2 P P "P PP  P P~PT 0D@1 1100` 1 1 @,000S10@Vp -L `p \1 0P@0^0;\0S ^&^ ^"\ \ \@"\0@1 \\^  \01V 0;S00  -LBM䠟 P, XO0001 JKPD =r@P9 s`@01101@aT@# s00T0110{1s@P  rPldeP a00P a00$0zrwr,1X p-LP`@Q pprP @2Sp 0-LMP @0S _K,tK ">K*P.0 B0S 0 0-L 00 000000 !0 00 00@0P000S00000S +,0S d0IrP H000S 80 10$(,048<@ p-L̠ 0@ R, 01P00U#0`A@A@0@0p00h0 0\0$0P0$0 0<0(0P00UpDHtLPTX -L$ Pc 0z0\ -L3 -L P @`P0d00a0qFpP0 q + R00S R0K0@ b1@ ]1P`0qP0  Q10} T*,0  r`dhlpt 0-L P@0@x|0 -L∠ !30x00l00 ~rR 1 D00!~rRA(07000  0-L ML P/@0!08@KE0$0//0/H0 -L,M < @ 20L0 0L/@0D0 T D0S S 0L | 200 0H0 |0H/0P0 @30\00X0D/L0P/0S P ,0D/_@`d18pKAP~u 00D1/81/P`VP1/`0@1U0/0T0 `V`08pK0A/0/0S00`VP  T0S t0|/< RD0QH RP@00@0 D  D Ro,00@  @ -LM< KF,0R/$0 N/0J/  -LMD p`820 P02QP$22/2./2@0`2&/ 1!/1/U 1.Z10 10000#01Ul10S 1/t1 2`1.T1 00HtP3U $100 0 0U31.@t0. 0K0.00.0,.000@00 ` H0@00 0l00 0S0<$ P1J.H1G.@10 P810 @ 1 10 002P00 000000@A0$.p 0S W0000 00.. P P `00 W00R0S @0000 80-  $(,0$48 -LP0 -L P 0-000S00- 1 R00 S  6 R00 S Rx0 00 3 R00S  2 R00S R$0 000-<<@DHL -L0M @`p00 P0nPT 0 (p0y P .P000S |0o- P$pT .p@000S 40\-Z-$0W-!PTX\`dtW 0@K 55@0PA-?-P@K.9-7- 04-ht 0-L젟 000@0!-00T31,0^-0p-0l-0h-0 d-t0`-h0\- PX0W-L0$S-@0O-0x$lptx| -L⠠ 00 @Pʌ0, -l000S`0\000< T00Q0#S8040 00 0H@\ 0-L⼠ PPʬ0,0 -@000S |0,0tP`0 3E?6C#::0-D0,80,000@(00P0h\t -LqMMT  '   p` g hPK@( ,g  $'  IP, 2 20 (7P07  S 2@?,=, '(P2k  Q|2b  ' ' 00)0007S @2@,, 'P2H  K(0 S 1@ N,K,H,1+ 1+' TX$G@t1+$Q `1+X1",L1,,'$P $1'zP1! 1+p$'R w 0+(7S , 0壄 032R 0+9D0+0!S:KNnK `F'R K!.'!P X0l > `?Q 3+?0Q p3+lPO^KPEO>K 0C0, \0!>C0@!S@*p1Pd1, `;P8, P1RD1N(%8"S (1 001B1>1 00 00S 0@ 0S0S 00S000S%000t     8    x|| $ ( , 0 4 8 < @ D H L ,0S ,0? 0008< l;P  -LM⨠ p` `FP000U|0000 l00,0 0 0AT0#03T03S  P, 0U(px| -L -L -LP L000S S 0 0K0C1P !P0088 ` 8088$ 0<"8"@"D"H"L"P"T" -L4 0 00000'>xNX" -L⼠ @P0 00 pgT0oLP |0H  T0^LPa @5S  R(00 $N\"`"d"h"~l" -L M M| @`p00 T@D‚.K00^K@L@$>K0C5pP (0  0 %,Mp"t"x"0$ t0 K d0 T@>K1@T@001@01`0$0$)0|"""H"" -LM M† , 0 Pp00 8 T000SH0 0( < $000S 0f zK"\""10 `10 p10 10 10 048 10 PU NK@D1fKcKWVYX48S< NK@DH1TKV81OKNK@D$1IKW 1DKNK@D0>KX09KNK@D03KY0.KNK@D0(K4Q0"KK@x0K>K0C,0 10 10000@08<(0L\ """ "$"("@"D"H"L"P"h" -L  -L \ 8 0) 0  \  -L☠ 000 S X0 L0H0D0@0<0804000 H"""""""""" -LP HH04   "0Q8#81PG!" p-L `0`000S 0 00000p00@0P@D0PTT`000S T0 00080 00p0000`p`G""""$ -L⸠ @p`@@T |0P00`000@T@H000T 40P0`@0TDF"" -L蠟 @pP@@Tʬ00`0E4#01T#000@T@l000TP0pP0`0E4#01T#@0T%lE""" -LM⨣ p4 0 30304  |30 t30 l3 h30 0,0 \304  P3P00D30 <30 430 ,3@DI`fI P`30S280 P"< 00@0 200S Y Y-00000 R 2M0,0 000S< @ 3IP  @0,I @0 100S >Y,4  4 0S 1,  , R| 0S <0@IP  @ H @0 (100S CY"8 @0S0 00f,00,0 0S < @HP  @0H @0 0Socp000S`0+Y1T00@0#\D"""""J]""""""""""#P0H00<04yw0## ##D0<0@80,00 04#"## # -Ll h00\00T0 00H00@0<0$01Q?# #$#(#,#0# -Lp h0 d0@0H000S0080 40 0R 0 000>,# ##(# -L␠ 000Sp0 0@0SX0000D0D00 0R$0 000X>$## #,# -LⰠ 000S0 00 0R p0  d000R00D0 @00 0R00(0 000=$# ##4#,# p-Lx t00 l000@T@T P0`@0P<0@0T@000Tp<# #,#8# -LP`pQ 0R 00C Rg000Q 0@lT  DI0p~000@T J@T0pn000 -LMp`P @At  0@Dt -LMԣ `080 40 pZW4 W [R/ KpQ40KH000K!A0BS p p p p p 0K 40KH00 80Kp#R R R@ R( R_ R R*  Ro R R R1 R R R W0 Kp2p80S 800C80 S8 40R*80080 80S 800C80 @@80T:@ @40T:@{@40T:040 80 84P*@`@T  H8 a_0@DSU8 40R*@ S@40T:L @D80R#804u)80S <800C80 S8 40Ru*@ 0@40T::<#' @D80R8040 a8P^ 40@`0@80  H89 0@DS400C40 BpRPU680S 800C80 S8 40R*@ @40T: @D80R8040 hFsF4 80S *c4080 `00 8 K40KA R RP0400 000S!S {0 0000@#$# # 0-LM8 P ,0@0S:00Kd4D#0 -L -L -L -L -L -L -L -L -L -L⼠ 0 1R @QQ 0Aq  R  R Q3H# -L0 4 8  -LMԠ Pp@`00 K0d` ;#;`S0#8#8`St0K`KAd0S P000@0lT40hPl0hS2L#P#T#X#\# 0-Ll P@080q!L00 0D00$040 80xI@Q 0$01`#d#h#l# -L@  -Lؠ @`Pp `P0S I@Q 000 8 bH80pc@0S[<8P 40,0<I0p#t#T#x#|# -L8 00 1R Q/H# -LM̠ p KsPd`KK@P  SGPh0S x0pd0\0P0l jH@00lT/##### p-L @P0@00T1*P0` '%@T:p0DP  ? R00S RPPT0@P00T*@0`lDP  0@T:p.#### p-Lt PPd0pX0@T00T*D0` EP $0@T:p-#### p-L` PX0@T00T*D0`$DP0Sp@T:p,## -L| P`p0@l00T*\0p0S DPCP@T:l,## p-L` PX0@T00T*D0`0S CPp@T:p+## p-L⠡ `P@1 ? R00S R 1`1CP  ? R00S R $1CP1;pV@T_@T 0S ? 0 ap0x0p@PX0 H0@@00000pP+###### -L(0  -L(0 -L(0 8 -L Q Q Q( 0 0( L40(0( 00( 0C 0,, -L( -L1S ( 0 (0 -L( 0 -L\ X0 P00R <0 8000(0@0  0 !L($# -L 1S   -L P`@pRp1 00@DV PpW Tp T00 `@`@T P00@H00 X00R0S $0yX@'### -L 0 0\&# -L 0  $&# -LMⴠ @P, `R`0p00spV h000g, S U P _p ' P@ %#P@T L00@D00 Y00R0S 0Y@### -L 0  $# p-L`P@R @T 0Sp -LM✠ Pp`Q! 000S BW 1 !0@KEP0 A /00 /0C0 $0# 0-LP@A 0 -L@ -L$0S  -L 0S  -L 00"$ -L 00h"$ -LM@ 8000S K00K00K v0"0$ 00|$ -L 00!$ -L  00 R!$ -L$  00 #D!$ -L 00r!$ -L  00  $ 0-L M4 P$@K  0 #0 0-L Md P$@K D040 ~08 ###0 -L M@K jr -L M@K! ]e -LM@K PX -LM @KM 0-LM0P$@K @@T* @T:$K60 p-LMx Q d`,@K`0P!1 10A0 0R\, KL 00\00#00000C0p -L| `pPA@Dd0000S T0 0R 00W4000@D R00## 0-Lؠ P00 R) 0@\0RP \00 xR oR 00B0 S a0BS0A0BS00000S00  R0@\ -L␠ `0P00U*t0p@@ X@P0SPU:,00~L#### 0-L∠ P@|0mkl0`0 \00 80<0 @0R 0V0##ptld -LMMd , T1=L1 H10 80@<0@`p 1R%1*1n0! !0e00 00P0U 10100 SP0U@I,@T* R 0S 0S @T*0 S@1B^KPE#ptld$$$DB>K0C0c S00T *0S S S@ 0 S S@00B^KPEL0<0YT*0S S $# p-L` `@P0PV @0 f?PQ VPPpt$$ -L p-L☠ 00`0|0x0Pl0`000e@BDHADA@0 OAp$$ $#$$#($ -L `PpX0p>@0CA0><090S T P@ A >  9 0S ,$0$4$8$ -L@b -LM☠ `00IK@@K@ @_K@"K@ @ 0hX R $00$4 $ BKAs<$@$IKK -LM젟 p< 0`0800VC*Ȁ8KPW @T <0>PP@TPU) x00S :SP0  c40 #D$#8$H$L$P$,0 `00V:T$# -L0S 0S 0S =P 0S 0S   0 S -LM@Q11 00000000QR10  X1P1 000000000 AQ000@DS(0@R10 0SR!0 @Tڬ0Tڤ0CRQ0 0<@000 \ @T0,@R!@DT0%H%'8&''<&@&p 0-L蠟 0 0R- B!  00 B!000 000 PB10 BA0000PEST000$0 000000%%'D& -L` -L⸠ 1`pS@Q0000@DS|0r0 mL@Q0000@DSb01`p'x% p-L4 ` p* 1 00ARQ0000@DSH0@bQ0 000@DS :0  0p00cp0_A000#0D00<@1`P`0@DS0p%'|%%H&L& -L q@  2Pa0000PESʴ0&0 O EtP@a@0PES`00  4008 @Tx'P&H&X% -L MⰠ 10@000S0 000S0<t0.0`0 0T@D@00  40 0X' %%%T&X& \&d0 0~T@0 0,0.00 `&d&h&l& -L MD 108000S,0 000S0 %%%00 00$0 0 00000X%`%$p& -Lh d0 `00011@t @00!@400S  0Q8t&%x&%|& 0-LMԣ B1@ 3<U  35N3.E(KP t3&H?;(0[0X3'0[ S0@-u+( 3P2[00!02P @K $.022[S p "1  22[Sqp`2\2P2( K0S+00S(2 BRQ0000@DS0S1AbQ0 000@DSu0 111( K0S*0Sh1HARQ0000@DSS0 S1@bQ0 000@DS}?0  n0j0lh0h00K0K(0[0S: S 3S 00[00K/2[0SR1  &&&&&%&&&&&&&'&&&&&&&&Sb1 0[R00K0*0&K[ 0(K40000S000KK[ p0 [ !P0P<0804000( &&&&%&&|%%&&0&0 -L B10SB #  0-L\ PBAP2U8000$$00000 0&& 0-LP PBA0$ 0000]P2U 00@& 0-L` PBAUP2U<000$(000000S0'' -LL H B@000@#@0 BS 0bT T'' -L⠠ P10@Tڀ0K@Dt `rq00 100S cVdV(04P@Dt '' -L̠ 000SPPpPEu r0`@000@10STTT0L0000pPEu0 00g0(''' -LⰠ p`PnP0P0@PWp`ū0S0T0 V@0 <000 0000(08 ''$'%(','0' 0-L` B10 L00@0P@T@(0 $0000o0T4''%% 0-L␠ B10 |00p0P@T @X0 T000L0w@0sG00nB!0004''%%8'<'@' p-L4 010  B  P P` ` 7   @@    z  @P !"#L$ B% &'()*+, } - ./0100`P@PpD'H' -L┡ pP1`0#4@0CSR 1:T1 A<1 :T T T 100000 00000S000T 0T$0 T+00S  PT0P0XPD'L'P'T'H'X'\'`'d'h'l'p't'x'|' -L Q00PH% -L⤠ 00@T0w00h000Q \0L00A  0Q40 00C00 00C0H%'%% -L< 8040 00000S'' -L< 80@0S (0500h'' -L 000S  % 0-L⤠ @Q0000 10 @2T\0@Q0@000@ 10 @2T00'' 0-L⤠ @Q0@000@ 10 @2T\0@Q0000 10 @2T00'' -L  -L 04' -LР 000S 000@@00 /0 Wt000!` 00X0@T0L L00H0@0''''''' ' 0'' -L 00' -L -L  0' -L800  $00 #00  -L 0!Р!0-^ -L 0A' -L∠ 2@    h0`003  H0@00) (0",00''' -L -L4 0000S 00''' -L∠ 00 0020q"00P00PD0* 4 :0K"P0C00''  p-L☠ P`uTV@|00 @Dd0T\0H0L 00D00@<0<0`P4 T0C00p,'( <4$ -L0, -L 00( -LM┠ p200 0PZet0A$`K d@!@K8H0 T.800h$0*'''' -L 00' p-L`P@   00 R   00 Rp p-L☠ @PPPPp0` 0 ?0P%@ 0! 00 \ 0000000100p4' -Lp`P 0" 0@" 0 "0R 0!U0$U0"TU^UP(T\&P 0 P,00S0 P,00S0 ,00S1.00Q 00T 00@R 00 S 000000 -Lp@@`PWp" T00 R0S LDP0 T00 R0S  TLD000LDP00000000xt t@x H400 H800pW' W$ `W" W W W 0Sp00 0@  0S, P  0-L@P}p 0 0@ 00 -LM⠣ P@4  0S 8 $ 8 0l# q0S 80 `0\* 0\:`8 R4X  40\<0 \(0X Y <0K0K ! 00\0 S Y< -K0K ! 00\ 80S X0Y 8 \ <0 \ 0\* <0 0\: 40$0S|C\0\s* <0 000\:j  <0 000\:0K0K ! 00\0 SN  <0 000\:-K0K ! 00\4  <0 000\:0K0K ! 00\ ' <0 000\:0K0K ! 00\0 0\: 0 W 40 \< 0S/ \0S 0\=* 0S\:3X008 R0S+ 0Y($00CS 0 S00 00\:\0K 1 0R\ -L M -L4M┢ @< @0 0L P @PT SX $ X  P20!\ <0 0R0@040 A D p H  43<0Y*Y 0S, P DQ< 0iS0 `*8`Q800T0 L @X RN;:TG000@T@000@T0K0 S3 H0T000@HT0K0 S T000@T -K T000@T0K@꼿'L0 00T0@0T:X R9 @8 K\1L0T00@T8K0 K R 0LT L P0pP  X0Q0 R0S  5K- K R T0LL P 0p P D0S<0iS*D@< Y0#03T0S 0 0@< Y0#03T0S00D0 <Y:@ P0S -Lp @P40QC` 0QP 0@T*00 000C `R,@T: -L M -LM`(0 0 4 @P 0Ri40Q3,0 00Cpp 000N 4 PK*W 4 a0R: 0<0@@ W*0W *804   @ Q*0Q:80<0Q @0 00 00, 0000 @00 , 0X4  4 p,00,0 R:4( -LMP`(0 @@40Qp( 0R[p 0004 D0S0D0 0Q 0 QQ* 00Q:0Q* 0 0Q: 0  (`P 0Q* 0SQ:  -L⸡ Pp@@ 00C  00C 0R401c %p 000C WA P 0100S 00S 0y0` 0 0 00S D R0R0D0 0pc`00SS000W0鐶'(( p-L⼢ P@`,0S0,0200200@D@ 0 00@ L200S= 82000Q000T,0S0 000 0 0 20, 00S  00<0>C00C40111e ct1` 01S<(0$0S0 S0$0 <(00S 0S 0S 0$0 00000002@0@0S 00000C000$000(0x00,0p0000h0040`0080X00<0pp鴴( (((((( ($(((,(0(4(8(<(@(D( -L⸠ @P# 0 00x0 00d0 00 P0 00<0 00(0 000 0000霱H(@ -L⸠ @P# 0 00x0 00d0 00 P0 00<0 00(0 0 00 0000İH(@ -L 0pD@ H'0 B'0@H` ;'0P 5'@@0`8`00@0D$!  l000 ,@P8`L00@0D$  4000 ,L(P(T(X(\(`(d(h(l( -L -L4 P,0,0@(0/mP餮L(P(p( p-LM `P@ (0 $  0[0W0 S0O0 KT* (0K0 ,0K,P l0d08 0PT@c *@0.40*@Ht(x(|((((((( 0(p -L u22 22`@01@T:2P@@T *1S 2t2PdU\2P@@T *1S $22PdU2@T*01@T:1wP@@T *1s 11PdUx1`P@@T *1s @141PdU$1I@T*A@T:0?P@@T*1S 0z0v0rPdU0$P@@T*1S P0_T0[40WPdU((((((((((( -LT @`HpPD0:T  P0/P鴩(( -L@ P40@ 0 0<(( -LMⰣ @`Kd %sTi3#Px3K00#40@KmD30#$ #805 s R00S  t R00S  d R00S R2K00#40@K:|20#40H2"P 42"P  2"Pj2"P1K00 @K1"P11"PK @P@1"P1|1"t1(K&d1 k ` 0[ PP,1 1K00#$ #80@K PK "0" "00ᱯ0M"P40K00#40Vب(((((((((())) ))))1("P |1KT+ʄKT1.L1"P <1K! 1"P1K00T :!PK0!K!K0!KE80 0K "$ @Kt0!!\0!T0fdD0a&) )$)(),)0)4)8)<)@)D)H))),0M$0J0G0DL)P)T)X) -LM M8 ` p30Y 0 R00S R Y 1 R00S RI`YU2q!Pl2h!P۪L2_!PҪ,2V!PȪ2L!PS1D!P101:!P 1@1/ 1*!PX1 00I`l1X`1F YkP1!P@1`,1 !P1 U1!PDP`0@0U*?K0 >K0C80(K0S 0TP` 0@0T:h0\0ꨢ'\)`)d)h)l)p) (t)x)|))))))))))))@3 P9Y(3F _` ?K0 >K 0C8 =K0C0S22u ]KPE00 0OK@ >K 0C< 0@ >K 0C80S;\2T2u P:Y(2 P?K0 ==K8 =K0C0S117 mK`F00TOK@ ==K<@ ==K80S|1i -K Bp1\14 P  @ 41Y  Y   /R0A z?S0%:*/Q050F0A0o?V ?K0 ==K0C8`0(K0S P0)))))))))))))))))X3iH3d/b?b 3Ve3 $P 2U2(2KK,!8K !w@ 0T*$?K080K000!!,==K0C4P@ T:r@ 0T *_K4P8 K   1!,==K0C0Ppp W 0 R 1=@ T:Y|1`VTd1w\1IP+P`D1@0U*?K0 ==K0C81( K0S 0TP`L0T:00$0P 0_@0U * $PP 0@0T:U D0&))))***) ***)** *$*(*Y|P3@Pv@3wP0Ul*=}K pG`?K0,0(?K0 0( QP =K0C0S 2TLD 0@? =K0C0S l2T`PVLo ?0TL?0L? L/R ʒ?K0S 2l`PVLo 0TL?0L? L/Rʎ?K0S 1SPL0T:U1t1x1eP&@ P@T1Y @Y  PT $P 0 @Tڍ08 P0? 0TY Q0R /@D)t0h0$$P @0;,*0*4*8*<*@*D*H*L*P*T*X*\*`*d*h*MK@D,Y @30003K00#$ #803P?U=K0C0,>K,P 2;#;S2PU2P/U#=K0C0,>K(P@mK`F}KpG, 0R@T;#;S2P?U11 P$YC 1i?K0/,>K0C(P|1x1plA1(0CRpWڿD1j PRY 1>K!.p ?KppWڎ?K0?,>K0C,P 0!=K0C0/,>K0C(P|0`pOK!]KPE8 0RGpWH0Rl*p*t*x*|**************$3PcpP Y3כP $p(0 2* 2WWE KU Q?0UDD?K0>K000,>K 0C0P \2sT2P8S 42U 2P?0? L8S 1U1L \|W11 P0YU 1{NK@DU ?K00/,>K0P1p QNK@D`pW1hY0dU0p P7Y 0DOKU @? >K0C8Pp0}pPPOK-pWښ*)*****************|22 P(Y K D2p W ?K0CpWڒ?K0/ >K0C<P1111 P3Y I`K!.TK Pp W ?K0CpT1WL1?K0?K000?,>K 0C4P000 P=Yw 0?K0"=K0C000/,>K0Ph0d0Apl@1(0CpWpHP"MK@DxpW*+**++*** +,3 PlY3 3YK!.K p"?KppWڒK00/K B00/K B00?K000?,>K0C4P X2>K0C0>K0C000/,>K0C0P 2dpOK^KPE 0RKpWp_KNK@D 0R 111pWg1 PY Y  @1? $PI 1  1P9|    p 04?   Y0P  / I`Yڠ0PI`Y$`P $p 0? (0 X0T0WUD0+*++++ +$+(+h*,+()0+*4+8+Q 0/ / pWV >K 0C0 >K0C8P>K0C 0P>K0C <T>K0C 8X>K 4\  P>K0C0S$?'2R 0 pc >K0C0S $?'2R / <000,>K0C0?!>? |?!>|?  |GW2|%|/R Y @P 1 11Y11|Pu1L1Jл 100<0/Rx1?*t1Yd1 T1 @P | 01| |?|?P 110S0e| |?S0  P  0r|OK A/P0 0g.K Bf|/p032R \0<+@+D+H+L+P+T+X+\+`+d+h+l+p+t+x+|++++>+P3=H3:@3~43z $P3 3'/?d2|h|?!S:ўKI~KpGQ K @!.@!P 2?Q 2MOQ x2F00PNK@D>K0C0 >=K8P{0S 2+/`1$Tp<0@@,>=K0C4<,>=K0C0P 0R 1x1l1@0UjP1D181@0TYP U!>/R |?!>C|? `!Su*0!0C0006000)x0t0k#++++h*++++++++++++++++|**+++++0KI 0F++ -L Br 00 -L 0 00~+ -L$ P@2p`20U20S 1P#1xPo s R00S  m R00S R 1cP 1 R00S R`V @P  @`P 1 1@P $ HT0 00S <`0`@ 0000000 000$0|00(0Pd000D0d~,,+, ,,,,, ,$,(,,,0, -L$ \P0={, 0-L8 P01@:P @0000@P0 0/S0000S/ '0000 . R00S R . R00S  . R00S R@ P P0S@ P0T /]P0{, -LZMȢ @KA 00Kc P 0@0/S K20cKpP P0ST0T`V PFe P% !?-ld= cbs10@ -r-w  @Ss@-x -r-w  Ss-x-r-w-x8Q<N J0bOK,]X p0\0`T0VyD0{<0 ) 0s Xz4,8,<,@,D,H,, 0fL, -LhMpKt tK0P t 0-Ll P@P P/@P 80=;(080030vP,,T, p-LlMh 0`P@K@ KP P)0PP0hvX,p p-Lp `P@PT0p 0Pp0puX,\, -LPp|`PW00@XX:UPU  0&@W@ -L -Ln -L -LJ -LM࢟ @PT232PbC l R00S  s R00S RTh2Z- c R00S  a R00S  t R00S R:T6ڈ@K`PP1_]1P1@K 0 P`0[ S Sl1C [ 0B R_S?[V,1,1$1PT A  $">K<P0 0 2S0 0 ]0 d00pP+Tt@Kvx0 Ph0 KPT0T0<0dt`,d,,h,D,l,p,t,x,|,,,,,,,,, c R00S  p R00S pRAT=pUOK9noK5K 2@P& P(11 0P 00OK0 P00#0nK00 r R00S  m R00S RT"PD0D0@00k,,,,,,,,,,,,0ZX 0U,, -L 00n, -L  -L  -LD @ Qx<0x< 0n -L4M `X P|| R S R8pKp0S7X 0 \ XUA 30PR -L䠟 `0SX*p(B pA0W @T ~PP 00 P@Tpp PUW0G0083@a0S eQpGUWd -LM`p80 PQ4 q W) 41S  R 0SP 004 G81PU A4 K040H0?U0SUFWC04 R6 802<0 2pC 2W,PK 00K,< 00KPp@T 2Y0'0SW  (00C(0\ 00C00 4 H0XS  -LM⌠ p,0 `Q7 X PAQ  H,1P 00PE0?Y0SY aXP0 R 0 b40! 0000 PUZ 0-Lp @  P0SP(0S``PA 0`\ 00000 ` -LM( pPQ @aQW ( GT001S@T0X0Y0S (hP p-LP@` R 0 0S  1S RP0 000C0C`0S0&0Sp p-LȠ `PQp@Pp0EQ 111 d000Q111d H d@h00h0`00`0ټP @l00lp0^ 0-LP@d0Sdd0S @0d0h00Ch0d P0$00P0000000000 P  0 0-L@P P 00000P@0$00 -L \ 00  ,0S  0b01x  B  0-L@Pd00d@h00h00 -L@l0S l0嫼l00l0S0d0h0 -L0l0d0h0x01 p00p0t001Q 0-L䠟 @P0  R000c x01 SP\00 ^0S\l0  R000c x01 SP\00 ^0S0[?B, p-L@0Qp0` 0p R 01p0R $0S R^ p -L, R000 c !0p0x000 -LQ000c01 p p00R 01p0R B,0S R -L`PpQp@P 00000,pPP0H0D0@0U 0T0X0\0`T0T00 p-L@`PQP p 0-LP@P 0S ZP0 -LMp`(0 @ PPC @P< 0$0000Pp(000HPDP@P0L00800<0(P0@00 00W T T,0X0 0 0  PK@ -LM@ 0 00 00  0 -LM@ 0 00 00  0 -LM@ 0 00 0  0n -LM@ 0 00 0  0Y p-LMP` @00 00 FPp -L@` PQPp0<UP0SppRW PP0S 0@00 W 000 @P 0-L@P P 0  000 -L| @001 p p00R 01p00 R0x 1^@Q\S p-L@P0D0a$400S01<0840S P  <08pp 0-L@4LP4P8H8P0 p-L젟 t̐`QPPQ 0@N^00C^ࠣ@U00T0S 0\ 0\0 0c4 00S 0 cR `P@U00T0St̀pR p-L⨠ P`00c4 A0 0000+PP 0 000@00@000000c< 8 npppP -LⰠ @0S 0 000@00C@0L 0\L0 L 0RR0L0L 00c4 !00S  \

W; D?0R$$o`?0V44`@T P 0Q(00C(0 @DTY O@WDD@,00, 0TpT -L#P0S S TT 0-L@P0@ U0D0 00 -L@$ \ 0-LT @0  sP40S000 <0<0l6 -L@(0S0P  0S00 <0<a` 0`0 -LT T0S -L@T  -L 0 0 -LP0S z p-LM`P0S30Q PA 0 00  00FOK,c 0POP0S Rp -LP 0   -LM@P0,`Kpp 07'[P 0p 0+'[P -L#M$ `L  0 XO a40!P" a< 801 0P00 H" P0H2 D  HP00\ 0 S -KT" D员)8@K00  0 -K4[Pp<0p<T04?7"SDPH @00@0 H" DD2H00D0lp,0p<@246S-  b<802 D"Q !010P0 00T"? 3@@ 0@2$& BT0#3$X0SX 5T 5  b<802 D"Q !010P0 00OK  0pp ]K?8"@0  0#20  R $ 0002  T04?70CS000P0 1001801<01@01D0 1H01L0$G0D000P0 1001801<01@01D0 1H01L0$ 000 PP0S0P0T0T00o<U000<06 0 R7560 -L0S-8H$A@ 0. A@ 'A @ 0 A@ A@ 0A@  A@0$A @ B 0000 0 00  0 R -L0a pf0S, A@ @A@  AP @ A@@ BP7 56 07<607@>60P7460 R756 0 -L -LQ R+00 01 #00 01 #00 01 #00 01 #00 01 #00 01 #00 01 #00 01 # BRR 00 01 # R -LP 0S@@@@ 0S0000 I -L@P 0S $0S0P $($ 0-L@PR 08Q1S 0T0 00 R0 0( $0S0$0(  P0 0  0 UPe 0 00ES00P0 0L S%0P 00P@P|$ -L0  -L@P 0S 0S Xp00 S4x(x4 0Sp00C0000 000 S  0020#20 S 00|2 000S p00C00000`0PP 002  00  000S p00C0000 0<0  000S p00C0000 080 000S p00C0000 040 000S 00C00000 00 00000 0000 000 kpw 00 0C0<WpWNp   0S 00+ 000S7 p00C0000 0<0  000S$ p00C0000 080 000S p00C0000 040 000S p00C00000 00 R 00400 00 00 -L`@pPP 0S 0S  B 00P 0 004C@D0d`0 f 00 p-L`P 0Sp 0 S 00 0C0\p 0Q00\0S 0R 0Sa\  Q0000c 000Q @P@P 00pp -LP 0S 0S0 0-L@PR<0000CS( $0Se  (0400080S0 <00 -L@p(@  `P (Z. P$PU($(  (P 0,08 ($$($ -L@MP`L P p4 T 00Rb0J2,0%T%a 0 Sdt\    Y L IP0P pW@000SJXhpG@8pd00`,K0K4 K80Kg`,04 80tP p0P 0c 00P00T4 +ꨁpG0ꨁpG0ꨁpG 0030 p0P 0c 00P00T4 Y L IP0P pW 8#8"S 0030 p0P 0c 00P00T4 8#80pS0S000Y p0P 0c 00P00T4L ZB,0T R 00( S T Rb0J2,0%T%a Z1T 4 L CL 40T0 00TQa0J2,0%T %b ,0TQ 00( S T Rb0J2,0%T %b Z p0P0c 00T 4 L 0L0 @ T @! T @!TK PP dT  T d00d0S0S00Y  0L0 IP0P p WI$I@0S20S 00L00 p0P 0c 00P00T4 7Th0(  P p0P 0c 00P00T4 (pG00000#50 R*Ÿ Y L IP0P pW  01  威pG0#50R:0 S lŸ0 00 S00`  $0Y@P L@ t( $ 00 p0P 0c 00P00T4L 0000r@W *Y L IP0P pW:d1! 01@P8pd   RP@  0W * Yj 0L0 IP0P pW:8pd0 108pl 20<0 QP\( $ 00d00 p0P 0c 00P00T4 SP 0 1U 0 ^@0" , 0 R:00 H 0<0 @<0K0@0K0D0K0$0 0`  H0K@P t( $ p0P 0c 00P00T4 `H<@ D05P p0P 0c 00P00T4 ( $00 p0P 0c 00P00T4L  L PL  L X0P0 p4T 00Qa0J2,0%T %b 0Sk 00T040L IL 4T 0 R p0P 0c 00P00T4L 00 p0P 0c 00P00T4 p0P 0c 00P00T4 u p0P 0c 00P00T4L d p0P 0c 00P00T4L S p0P 0c 00P00T4L B p0P 0c 00P00T4L 1 p0P 0c 00P00T4L  p0P 0c 00P00T4L  p0P 0c 00P00T4  0-LP@ (($($$($0 0-LP@((0@4@0@0 -LP -LM` 0 0h0 d0 `0 \0 X0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 ` hK0 0 !000Ph0 S& d0Sh K\ 1S p0S010 ,0Sh KP 1S Q! 0<1 \ *h K 1^ J \:h0K1Q Zh K000 dK KP 0 P` K  \ !000P:0K10  0`c  Wh0K 0 WP`fX!f 0Q0AjhK\*\ *0 Qb\* Q000ZS !K0 00Y 0K0 <D 0@0l0à0I!0bQl!0! 0 W0f0,D1Q?0#@#* 0 S*S ` 0@P 0 0b!P @Q0f 0Ơ\*10\:0Gà    60C0 K !S I0`c60C 1RJzVp WO^Q -LMp@`P0(0 (  P 0 `( K   @t00t 0S00@($ -LMpP0,0 (  `PW 1000 0,0K0`  0S@P0St00+ t) 0%00 00000 0,0K0`  06@P 0 d0W00R0S tX00 tL0 t @00@($t,Php($ -L(  DDDT -L@P`p0(  P 00@P`p -LM@P, ` 0 p00@^n0L2,0%n 0 Sp|X(h03\ Y& p00 0c 0000040 n, 0 p00@^n0L2,0%n ,0S S 0000 00000 W *Y , I0 00 pW:42! !08pc0S0000 000000@X 00 0010 p00 0c 000004 W *YV , I0 00 pW:(110 008pa0 00000 W *YI 0,0 I0 00 pW:0! !08pc0 000 000>@ 00107 00L00 p00 0c 000004 PUW *Y , I0 00 pW:p310 0 08pa00 0c(0Z*, 0bZ:0S9 \*,0^ 00( S ^0n0C2,0%n \4, , 00@^n0L2,0%n ,0^ 0 (0R ^n0L2,0%n \ 0,0 00L,0Z(00C0S00\:,0^ 00( S ^n0L2,0%n \+4, , 00@^n0L2,0%n ,0^ 00( S ^n0L2,0%n \ p00 0c 000004,  , 00L vWpG000C00 4, , 0 @40R p00 0c 000004, 00 p00 0c 000004 o p00 0c 000004 _U p00 0c 000004, N p00 0c 000004, > p00 0c 000004, . p00 0c 000004,  p00 0c 000004,  p00 0c 000004  -L 0($ -L`p 0P4 U@e,0@e0T@z00T0S00d000080S < <0 zP, U%(P40S4P40@e0T@z00T0S00d000080S < <0 QP 0P  -LM, 00 p`@ 00(U*eI0d1^!@`nA @00c 00`4P,0e2 4 8 @D0Q4 01, \s D00cc  10 0 lQ@D0Q8 010 ؁00c=  Q*@D0 Q: 10 00 l n c(0R*,0H R:,0b ^ l00\( 00^J0000N00^@0000N00^6@0! 10!0@0! 10!\00c00I XX000d1^!@`nA @00c 00`4PUX0Y T[0d1^!@`nA @00c 00`4P -LpH$H X`QK01W 1 !pbR30@P0@P0@P0@P0@P0@P0@P0@P0@P 0@P 0@P 0@P 0@P 0@P0@P0@P` BRR 0@P R(@ PWFLASH_BASE= Evacuating 1MB of Flash to DRAM at: done Make DRAM section cacheable: Map Flash virtual section to DRAM at: , Rev - for Balloon [BIG_KERNEL] [MD5] [NAND] [YAFFS] [MONO] >> Last link date: Contact: bootldr@handhelds.org Contact (Balloon): balloon@toby-churchill.org >> Last link date: >> Contact: bootldr@handhelds.org Cpu company: DEC Cpu Architecture: StrongArm Cpu Part: SA110 Cpu Part: SA1100 Unknown Part: Unknown Architecture: Cpu company: INTEL Cpu Part: SA1110 Cpu Architecture: XScale Cpu Part: PXA250 (Cotulla) CPU made by unknown Company: revision A0 revision B0 revision B1 revision B2 revision B4 processor ID: >> ARM Processor Rev=>> (c) 2000-2001 Compaq Computer Corporation, provided with NO WARRANTY under the terms of the GNU General Public License. >> See http://www.handhelds.org/bootldr/ for full license and sourcesPress Return to start the OS now, any other key for monitor menu Rebooting...parseargs: argc= haystack = <> needle = < helpboot> quitACK0 partition -- displays the partitionspartitionpartition show -- displays the partitionsshowpartition save -- same as params savesavepartition delete -- deletes a partitiondeletepartition reset -- resets all partitions to the defaultresetpartition define -- flags: 16 for JFFS2, 2 for bootldr, 8 for rest-of-flashdefinenpartitions= base: size: end: flags: usage: partition delete part_name usage: partition define flags 16 for JFFS2 Error allocating space for name +basestr is "+" jffs2 bootldr sector must have flags set to 2 bootboot command failed, entering monitor Probing bank0 memory size... bank0 memory size=0x in megs: M MDCNFG=dram_size_ptr=Probing memory size bank= dram[0]=seems to be no dram in bank= mem_size=[i] mem_saves[i]=maybe mem_size=found= mem_size[i]= memory size=probe_ram -- probe for ram size and banksprobe_ramn_banks=dram_sizes[0]=dram_sizes[1]=&_start=FLASH_BASE=boot_flags_ptr=*boot_flags_ptr=boot_flags= enabling mmu setting flashword=probing ram DRAM size probe failed! SDRAM size: DEBUG BOOT: not evaluating params DEBUG BOOT: use `params eval' to evaluate parameters. ** NO MACHINE ID **. Refusing to autoboot type "?" or "help" for help. flash_type [type] -- print available flash types or set the flash typeflash_typeflash_width [16|32] -- print available flash width or set the flash widthflash_widthflash_width=32 16 1632Invalid width: must be 16 or 32 md5sum md5summd5sum file [partition_name]fileUsage: md5sum file [] Usage: md5sum [] Usage: md5sum

[] rooterror parsing base addr: error parsing size: display display -- dumps the SA1100 registersdisplay SA1100 Registers: UART: UTCR0 0x00 UTCR1 0x04 UTCR2 0x08 UTCR3 0x0c UTDR 0x10 UTSR0 0x14 UTSR0+4 0x18 UTSR0+8 0x1c UTSR1 0x20 load flash -- xmodem receive to flash (see override param)flashloadusage: load flash error parsing flash_dest That is bootloader space! Use load bootldr. Operation canceled load ram ramusage: load ram error parsing img_dest bytes loaded to NAND chip not detected uncompressing gzipped bootldr bad unzip of gzipped bootldr Not loading invalid bootldr into flash Looks like a gzipped image, let's verify it... invalid gzip image. Sorry... img_size is too large for region: programming flash... unlocking boot sector of flash erasing ... Erasing NAND region Erasing from 0xErasing bytes 0xnand: erase error! erase error! writing flash.. Programming NAND region Image must be a multiple of 512+16 bytes for yaffs partition YAFFS image: Programming/Verifying 0xGzip read error yaffs_src[512+4]=yaffs_src[512+5]=oob_read failed, aborting Block ok at page 0xBlock bad (skipped) at page 0xWrite failed at sector 0xRead with ecc failed at sector 0xBad ecc sector 0xBad 1st ecc value 0xBad 2nd ecc value 0xNAND write Verify failure Sector is 0xOffset is 0xIndex 0xDownloaded 0xRead back 0xYAFFS partition programming Success Gzipped NAND images not yet supported Nand write failed Nand write succeeded addr: data: error while copying to flash! verifying ... Verifying NAND device nand: read failure nand: verify error at ram address 0xnand: offset 0xnand: ram value 0xnand: read value 0xnand: verified ok calculated crc32 = 0xdesired crc32 = 0xerror programming flash (crc check failed) error programming flash at offset= src= flash=not checking any more locations formatting ... done. load flashregion -- upload an image to the flash. dangerousflashregionCan't load to partition <> while running from ram. Operation canceled loading flash region using xmodem download error. aborting. img_size is not a multiple of 4 -- are we sure that's OK? load [partition] -- xmodem receive to flash partitionload params -- xmodem receive to flash partitionparamsError: no partition named Here are the defined partitions partition is a bootldr partition: requiring a bootldr or parrot image. is a jffs2 partition: expecting .jffs2 or wince_image.gz. is a kernel partition: probably expecting a zImage. After receiving file, will automatically uncompress .gz images bootldr:program program could not find flash partition programming flash partition ram src = len =usage: program save Could not find partition boot: nand chip not found nand_upload: Reading NAND partition nand upload: nand chip read failed nand upload: partition read ok BSD checksum is = 0xnand upload: About to xmodem send nand upload: xmodem error. nand upload: ok. About to xmodem send flashword= base= nbytes=download error. save all -- upload all of flash via xmodemallsave flash -- upload flash region via xmodemusage: save flash error parsing error parsing flash_dest=flash_size=save ram -- upload dram region via xmodemusage: save ram error parsing ram_dest=ram_size=peek ram -- reads 32 bitspeekpeek byte -- reads 8 bitsbytepeek short -- reads 16 bitsshortpeek int -- reads 32 bitsintpeek flash peek gpio gpiopeek ram requires arguments! error parsing addr addr = value = poke ram -- reads 32 bitspokepoke byte -- reads 8 bitspoke short -- reads 16 bitspoke int -- reads 32 bitspoke flash poke gpio poke ram requires arguments! error parsing value poke ram: addr= value=flash write failed! breakpoint [delayed] -- TODObreakpointdelayedPC breakpoint will be set after kernel unzip at: Setting hardware PC breakpoint at: Clearing PC breakpointqflash id | security | qflashqflash requires arguments! idsecurityvalue = eflash | [] | chipeflasheflash requires arguments: | []|chip! erasing partition chipCannot erase whole chip without setting override to 1. erasing flash chip error parsing addr: addr=error parsing len: len=Cannot erase first sector without setting override to 1. pflash 0|1 -- (1 -> protect, 0 -> unprotect all)pflashpflash requires arguments: 0/1 (1 -> protect, 0 -> unprotect all)! error parsing protect: error protect value must be 0/1: addr= len= protect=Region specified is out of Range. Please use a range less than:call [a0] [a1] [a2] [a3]calljump [a0] [a1] [a2] [a3]jumpusage: call [a0] [a1] [a2] [a3] last_ram_load_address is 0. error parsing vaddr Calling fcn= a0= a1= a2= a3=physaddr -- returns physical addressphysaddrphysaddr requires vaddr argument! vaddr=paddr=sectionDescriptor=invalid baud rate: Please, try: 110, 300, 1200, 2400, 4800, 9600 19200, 38400, 57600, 115200 or 230,400 update_baudrate: new baudrate= baudrate changed to 0xMMU Control word=cmdex [0|1] -- use extended commandscmdexuse_extended_getcmd=0xAutoboot is DISABLED ledblink [on time] [off time] [off = 0] -- blink the LEDledblinkttmode [1,0] -- go into ttmodettmodeser_con -- start a serial console sessionser_conirda_con irda_con -- start a irda console sessionirda_conirda not available yet, starting serial console. memcpy [size]memcpymemcpy needs args: dst src num [size] bad dst param bad src param bad num param bad size param memcpy src: 0xdst: 0xnum: 0xsize: 0xBad size: 0x| hex_dump [size]hex_dumpreset -- software resethalt -- power downhaltFeature not available on this hardware. addr1=0xaddr2=0xw1=0xw2=0xmemcmp [size]memcmpbad addr1 param bad addr2 param memcmp a1: 0xa2: 0xver -- display version infovermem -- show info about memorymemFlash memory info: SDRAM memory info: SDRAM size:SDRAM bank0: mdcnfg = 0x mdrefr = 0xmemtest -- test mem between addrsmemtestmemtest needs args: addr1 addr2 seed bad seed param bad fillval param store vals . cmp vals mismatch, want: 0x got: 0x addr: 0xmax_mismatches exceeded, aborting. cmp done *********num_mismatches 0xtestjffs2 testjffs2 -- TODOtestjffs2read which file??? bad dst param copy the file to where??? infojffs2 [partition_name]infojffs2timeflashread [partition_name]timeflashreadls [partition]ls/load file [partition] [filename] [dest] -- jffs2 read filecowerror parsing clearmem [num] [dst]clearmemcmpkernels [dst] [src] [len]cmpkernelswhich kernel partition? bad len param enable_caches [dcache] [icache]enable_cachesbad dcache param bad icache param asmEnableCaches = out of room to build params list! + pef [just_show]peflli -- low level coprocessor infolliARCH INFO(CPR0)=MMU Control (CPR1)=TRANSLATION TABLE BASE (CPR2)=DOMAIN ACCESS CTL (CPR3)=FAULT STATUS (CPR5)=FAULT ADDRESS (CPR6)=MMU PROC ID (CPR13)=BREAKPOINT (CPR14)=Program CounterC (PC)=cat [partname] -- show file from partitioncatcat what file? jffs2 read [partname] -- reads jffs2 file into dram at dstaddrreadwhat dstaddr? what file? Reading file: from jffs2 filesystem in partition: . Writing contents of file to address Number of bytes read is wrong magic: wrong arch: Not linked for flash, start_addr=Does not support this CPU, boot_caps=BSD checksum nonzero parrot word 0 ->0xExpected ->0xparrot word 0xFFC ->0xor ->0xparrot word 0x1000 ->0xExpected ->0xwince firmware 0 ->0xExpected ->0xfirmware word 0x40 ->0xfirmware word 0x1000 ->0xExpected ->0xYou must load wince BEFORE loading Parrot discover -- guess what machine I am; see mach_type for resultdiscovermach_type ->initialize_by_mach_type done tdz -- test decompress routines (best with ASCII) preflashingtdznot enough args, need error parsing address error parsing dAddress verify img = uncompr size = finished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xErasingEnd Detected Skipping Copy of Flash MBM29LV400TC_1x16MBM29LV650UE_1x16No flash descriptor: reset flashprogram flash worderase flash chiperase flash sectorerase flash rangeNo flash algorithm known for CFI vendorID=the flash sector needs to be erased first! flashAddress= flashWordOffset= flashContents= value=Upper bank of flash timed out!!Lower bank of flash timed out!!programFlashWord timeout value= oldFlashContents= &flashword[flashWordOffset]=eraseFlashChip timeout flashp=eraseFlashSector: sectorAddress must be start of a sector! address=nsectors=eraseFlashSector timeout timeout=Erasing sector amdFlashProtectRange: unimplemented!! Flash types supported (2x16): Flash types supported (1x16): Current flash type is Flash size: UNKNOWN! setting flash type= Unknown flash device type: for flash organization: 2x161x16 get root partition failed assetbtflash_add_partition: could not allocate memory for partition table allocated partition_table defining partition: no partition table! no partition <> found partition <> deleted QRYNONE Flash style = verify flash size... verify flash size failed. Using fake CFI table for JEDEC chip <> No non-CFI chip detected. Ignoring fake CFI table. Resetting flash algorithm. re-verifying flash size... btflash_init: mfrid= devid=mfrid=deviceid=walking flash descriptors () btflash_init: found flash flashDescriptor= flashSectors= nsectors= flash_size= flash_address_mask=btflash_init: FAILED! Unknown flash type! protecting the bootldr flash_addr_shift(): bad bt_flash_organization=flash_make_val(): bad bt_flash_organization=flash_write_cmd(): bad bt_flash_organization=flash_read_val(): bad bt_flash_organization=flash_read_array(): bad bt_flash_organization=flash_write_val(): bad bt_flash_organization= ******** malloc out of storage ******** size=flash_iohandle_prewrite: unprotecting bootldr rc=eraseFlashRange returned rc=error while copying to flash! flash_open_iohandle: no partition named : out of memory jffs2_open_iohandlehda1:copy src dst [len] -- copy from src to dstcopyCould not open source Could not open destination destination does not support writing. srclen=dstlen=nbytes=command_copy: read failed err= addr: data: : write failed err=paramsbootldr:usage: copy srcspec = | | hda1: [] xmodem_initial_timeoutxmodem_timeoutxmodem_one_nakready for xmodem download.. startingRX PACKETTIMEOUTBAD BLOCK#BAD CHKSUMDONEABORTEDWRONG BLK Download Failed! Download Successful timeout nakgoto againboot [partition] -- boots off the specified/default partition (see boot_type param)bootwinceidevfatbooting ... kernel partition base kernel_magic=no boot image in flash kernel_region_words[9]=Linux ELF flash_imgstart= size= dest= offset= MMU Control=MMU PIDVAM=copying Linux kernel ... done Skipping kernel copy by request. : Copying compressed initrd from to ...Done root_filesystem_name=Grabbed linuxargs, argc = Using mach_type pre unparse setting boot parameters to setting boot parameters to linuxEntryPoint=Booting Linux image CP15 r0=CP15 r1=CP15 r2=CP15 r3=CP15 r5=CP15 r6=CP15 r13=CP15 r14=copying NetBSD kernel ... netbsd done! Jumping to 0xF0000020.. Unrecognized kernel image boot flash [partition]flashkpart=cannot find kernel partition named >< booting kernel from partition > nfsroot= ip=::eth0 initrdboot wince -- boots WinCEboot qnx -- boot QNX/NeutrinoqnxBooting QNX... dramFound a QNX kernel @ 0xERROR: No QNX IFS found - searched from 0xboot yaffs [partition_name] [boot_file] -- read kernel from yaffs file (see boot_file param)yaffsUnable to boot file <> Kernel filesize = 0xBooting file ""... boot addr
-- boots a kernel loaded in DRAMaddrnot enough args, need
error parsing img_dest error parsing img_size boot boot -- boots the bootloader, againMalfunctioned Failed BadPacket End of Text End of Session Timed Out Transmission Breakdown Buffer OverflowUnknown Error totalPackets= Transfer timed out Transfer canceled by reciever ackcnt=nakcnt=GOT a ACK GOT a NAK Transfer canceled - Maxuim error count exceeded Upload Successful Transfer may not have competed Bytes Transferred= impossible condition #876 Verifying gzipped image . verifyGZipImage: calculated CRC = 0xverifyGZipImage: read CRC = 0x1.1.4inflateInit2 failedinflate error :0xstream msg = calc crc32 is 0xread crc32 is 0xfinished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xhelp [command] -- Displays help texthelp ?apropos -- searches for text in help descriptionsaproposapropos Trying to load help... you can't execute the cmd <> while running from ram Don't understand command RXSTAT error: MSG/ *0x == HEX_TO_ASCII_TABLE corrupted strtoul: leadingZero nchars=strtoul: base16 nchars=strtoul: base8 nchars=strtoul: c=baudrateautoselectosyaffsboot_typeboot:zImageyaffs_boot_filekernel_in_ramkernelautoboot_kernel_partforce_unzipnoeraseoverrideicache_enableddcache_enabledentryuse_initrdcopy_initrdinitrd_startinitrd_sizeinitrd_partitiondram0_sizedram1_sizedram_n_banksmemc_ctrl_reg noinitrd root=/dev/mtdblock2 init=/linuxrc console=ttySA0linuxargsmach_typerootkernel_partitionboot/initrdinitrd_filenameboot/zImagekernel_filenameptable_addrhostnamedomainnameipaddrgatewaynetmaskdns1dns2netcfgnfs_server_addressnfsrootverbosecmdexjffs2_sector_marker0jffs2_sector_marker1jffs2_sector_marker2/etc/bootldr.confconf_fileboot_vfat_partitionreflashrecb_cmdser_concalb_cmdusb autoinitconb_cmdboot vfatqb_cmdbootstartb_cmdupb_cmdrightb_cmdleftb_cmddownb_cmdaction_cmdsuppress_splashautoboot_timeoutsplash_filenamesplash_partitionboot_flagsenable_mmuget_param: could not find parameter params_eval: prefix_in = params_eval: just_show =eval param blk found partition table in params sector pt->npartitions=partition_table_size=+params eval [-n] -- shows the parametersevalparamsbootldr:-nparams -- displays the parametersparams reset -- sets the parameters to default valuesresetsetting params to default values flashword = bootldr_params = FLASH_BASE = sizeof(bootldr_params) = setting param <> to value <> set =setshowshow params show -- show parameters>> = <=<=<0xparams save [-n] -- write params to partition, if existssaveflashword=0x&__params_begin=0xFLASH_BASE=0xdefaultParam=0xbootldr: set "0xNot erasing and writing params sector. No params partition found. I cannot save params into Wince or JFFS2 files!!! no control function h3xxx genericgpio_init: unhandled mach_type=balloonPeripheral Power established console_linuxargs -- sets linuxargs to framebuffer consoleconsole_linuxargsset linuxargs="noinitrd root=/dev/mtdblock2 init=/linuxrc"debug_gpio -- set | clear | read | input | outputdebug_gpiosetusage: debug_gpio set clearusage: debug_gpio clear getGPLR =0xinputusage: debug_gpio input outputusage: debug_gpio output switchserial -- switches serial port argc times switchserialSwitching 0xid -- read the ID chip dataidMachine id: xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆuse_ptableuse_mtd_cmdlineyaffsrootfstypemdcnfg= rootfstype=cpufreq=59000-206400 machine_id="" Making core tag at Making cmdline tag at Making mem32 tag at Making initrd tag at initrd.start= initrd.size=command line is: usb init -- starts usbinitusbusb status -- does a status check on USBstatususb sercon -- switches back to serial consoleserconusb deinit -- sets usb_initted to 0deinitusb loop -- does a 10sec poll looploopusb version -- prints USB codebase versionversionusb spit4 -- spits 4 letters outspit4usb spit8 -- spits 8 letters outspit8usb spit12 -- spits 12 letters outspit12usb spit16 -- spits 16 letters outspit16usb spit20 -- spits 20 letters outspit20usb console -- switches to console on USB.consoleusb autoinit -- auto-inits USBautoinitversion 1.0rc1 aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaPlease disconnect serial and connect USB to the device. After doing so, launch a console on /dev/usb/tts/0 andinput a character. .Now switching to console on USB... Now switching to console on USB... success!! Console is now over serial. WARNING: previous failure initting USB. things may fail again this time due to a weird state. eeps! usb already initted! things might be in a bad state, so we won't do it again, kk? interrupts must be enabled. failed to initialize interrupts timeout disabling UDC timeout enabling UDC timeout clearing 1 timeout clearing 2 timeout unmasking interrupts Couldn't set Ser0UDCOMPusb successfully enabled USB not initialized! run usbinit first! previous failure initting USB. run usbinit again to try again. doing a single poll. Ser0UDCSR: reset interrupt request resume interrupt request suspend interrupt request transmit interrupt request recv interrupt request ep0 interrupt request still sending something else!timed out waiting for send completeproceeding anywaycount == 0??MASSIVE ATTACK failed :(MASSIVE ATTACK worked :)timeout flipping tx statusignored interrupthmm, TIR, but not sendbusy >.<Too late, underrunTPETPC failureRFSRPE.timeout flipping rx statusSST.Code: Whisky Tango Foxtrot (could not clear SST)FST. We didn't set this, who did?eek, couldn't clear rpc!timeout blocking on IPR next reset state errortimeout flipping statustimeout clearing resetLUSB: LoopingU_USB: Done done next state is error!couldn't set resimcouldn't set susimsent stallEarly term of setupno OUT packet avail. exitingfifo READ ERROR, not enough bytes, Stalling out...PocketPC init sequence detected - starting DMA herekEvAddressSET_CONFIGURATIONbad time to config!kEvDeConfig errorsetup phase: unknown setconfig dataCLEAR_FEATclear feature ep halt on recvrclear feature ep halt on xmitrclear feature ep halt on bad epunsupported clearfeatureSET_FEATset feature ep halt on recvrtimeout setting 1 timeout setting 2 set feature ep halt on bad epbad setfeatureGET_STATUSunknown ep in getstatunknown tgt in GETSTATGET_DESCRGET_CONFIGgetint not supportedsetint not supportedunknown requestquitting setde b/c SST/SE setcan't set de (MEEP)can't set ipr (MEEP)quitting setiprde b/c SST/SEcan't set iprde (MEEP)clear_opr() failed ASSERTION FAIL, fifo_count > 8read_fifo: read failure :(write_fifo: write failure!the UDC most likely locked up. sorry.so didn't clear oprcheckz0r, 0 bytes leftqueue_and_start_write donesh_write(): IPR set, exitingsh_write empty() Sent empty packet write fifowrote fifoDESC_DEVICEDESC_CONFIGzerovendprodNULLunknown string indexIFEPunknown ep index, stall unknown desctype, stall wanted bytes we didn't haveint init -- starts interruptsinitintint version -- does a interrupt version checkversionint readcpsr -- read cpsrreadcpsrversion 0.3sa Interrupts are already running. Not reenabling. enabling interrupts: handler, stack, irq, unmask, done CPSR: dma init -- starts dmainitdmadma poll -- polls once on DMApolldma version -- does a dma version checkversionversion 0.9 DMA from buffer A is done! *ding!*DMA from buffer B is done, but there is no buffer B. *poof!*DMA error! *wh00nk*yes, it's running.no, it's not running.dma-sa1100.c: dma_startsend: timed out waiting for DCSR_RUN to become 0.memcpyoutUVY ZZ YVUe03f not found File read error program bootldr 0x 0xexec-ing bootrootnand yaffs root sm:/root-balloon-std.yaffs.gzsavenand yaffs save root sm:/sm:/root.saverestorenand yaffs root yaffs cp sm:/cramfs/.cramfs root:/usr/usr.local.cramfsusage: build [ base | std | bootldr | bootldr.fast | bootldr.slow | boot | root [filename] | (for usr.local.cramfs)] also: build save | resore [ filename ] - saves/restores root filesystem to file Generally production should do and then or some similar filename nand [command] -- Does NAND stuffnand01nocacheicachedcachebothcacheinitwaitinitwaitnand: nand_wait = 0xforce_erase**WARNING** Forcing NAND erase is a *BAD* practice! nand: cannot get NAND device chipsizenand chip: size = 0xerasesizenand chip: erasesize = 0xscanblocksnand scanblocks: Scanning all blocks for bad block data Bad block. sector 0xscanblocks passed 0xscanblocks failed 0xmarkbadblocknand markbadblock: needs block number Block already marked as bad nand markblock: Marking bad block 0xBlock successfully marked bad Bad block mark is 0xmarkbadsectorSector successfully marked bad checkblocksnand checkblocks: Checking all blocks for bad block data Firstblock must be positive Lastblock is past the end of the device Lastblock is less than firstblock Checking blocks from to inclusive Skipping bad block 0xChecking block % Erase bad block failed block 0xWrite failed at sector 0xPage read failed at sector 0xaarrgh!! Verify error at address 0xcheckblocks completed scansectorsnand scansectors: Scanning all sectors for bad sector data scansectors passed 0xscansectors failed 0xerasechipnand erasechip: Erasing entire chip nand erasechip: erase failed verifyVerifying erase of all sectors Skipping bad block at sector 0xUnexpected bad block mark error in oob of sector 0xError in oob of sector 0xError in data of sector 0xnand erasechip: sector verify failures 0x0nand erasechip: passed eraseblocksnand eraseblocks: Erasing blocks Bad erase of block 0xtestNo sectors specified! nand test: Erasing 0xnand test: Actually Erasing 0xnand: erase failed Hello World.This is some news.nand test: writing sectors ... 0xnand test: writing failed at sector 0xnand test: written 0xnand test: reading sectors ... 0xnand test: read failed at sector 0xnand test: error index 0xnand test: read 0xnand test: passed readnand: Reading 0xfailed! Ok nand : data 0xwritenand: Programming data from address 0xnand: write failed - verifying anyway. band: write verify read failed nand: verify failed atnand: written data nand: read data nand: write verified read_all_eccNot a NAND partition nand: Reading sectors count=0xnand: Read ecc failed sector = 0xSector read ecc1 failed, sector = 0x ecc1 = 0xSector read ecc2 failed, sector = 0x ecc2 = 0xErrors = 0xread_eccnand: Reading data with ecc from address 0xnand : spare 0xnand: eccres1 = 0xnand: eccres2 = 0xread_oobnand: Reading spare from address 0xnand: Read spare failed write_oobnand: Writing oob 0xwrite_eccnand: Writing ecc 0xnand : oob 0xnand: write failed - verifying nand: verify read failed nand: oob verify failed atnand: oob written data nand: read oob data erasenand: Erasing from address 0xyaffsgzipCannot find partition <> nand read error Image size = 0xWrite failed to file <> result = 0xWritten ok Sending yaffs fs image Start your xmodem upload now ... download error. File size is zero. Nothing to save Can't load yaffs image while running from ram. Operation canceled loading yaffs image Opening <> Reading file length 0xYaffs read failure Cannot open file using xmodem download error. aborting. Looks like a gzipped image, verifying ... Invalid gzip image. Gzip image detected and verified Filesize must be multiple of 512+16 for yaffs partition erasing ... Erasing NAND region Erasing from 0xErasing bytes 0xnand: erase ok nand_yaffsimage: Programming/Verifying 0xGzip read error pageStatus =Correcting bad blockStatus =oob_read failed, aborting Block ok at page 0xBlock bad (skipped) at page 0xNAND write Verify failure Sector is 0xOffset is 0xIndex 0xDownloaded 0xRead back 0xYAFFS partition programming Success nand command <> unknown bootsmsmartmedia1Unknown partition <> Partition <> is not yaffs Nand device not found YAFFS Guts Initialise *FAIL* YAFFS Guts Initialised .../*** error *** : -> Free bytes = 0xDirectory not found Cannot delete existing file (but I may be lying) Deleted <Cannot create file Cannot write file yaffs [command] -- reset ls cat rm and writeyaffsyaffs ls | cat | rm | write path resetlscatInvalid filename Not a normal file Error reading file Must supply filename readFile read error File read ok File size is zero, nothing to send. Sending file size = 0xusing xmodem Filename not supplied writedownload error. aborting. File write error File created ok cpReading file <> length 0xWriting file <Error writing file Ok Cannot open <Filenames not supplied rmDelete failed File deleted Command <> not known $Id: yaffs_guts.c,v 1.1 2003/04/08 13:24:16 jamey Exp $lost+foundobj_TOOBIGobj$Id: yaffs_mtdif.c,v 1.1 2003/04/08 13:24:16 jamey Exp $nandmtd_WriteChunkToNAND: at block mark, writing 0x Division by zero!   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~23IRRSS                    " $ % & / 5 6 7 9 : < H I !!!!! ! ! ! !!!!!!!!!!!!!!!"!$!&!(!,!-!.!/!0!1!3!4!9!S!T!U!V!W!X!Y!Z![!\!]!^!_!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|!}!~!!!!!!!!""""#"6"<"d"e"j"k"""$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$#$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%,%4%<%%0q3r3s3t3u3v333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333)MNOPRTUVWYZ[\_`abcdefhijk  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^ %,37:>BFJNRVZ^aeimquy} !&).369<?BEHKNQUX[^adiorwz}  #&),/38<?CHNRUY^adgjnrw{ #(,16:>BFJORV[`ejoty~ "(.48<@DHLPTX]bglqv{  %*/49>CHMRW\afkpuz  #&),/258;>AFJNSW[_cgkosw{ !&+07@DHLPTX\`dhlptx| !$'*-0369<?BEHKNQTWZ]`cehknqtwz}         " % ( + . 1 4 7 : = @ C F I L O R U X [ ^ a d g j m p s v y | (C)<<-(R)u,>> 1/4 1/2 3/4 AExssaeIJij'nOEOEoeoesLJLjljNJNjnjDZDzdz'^'`_:~ -------'','"",,"+o...... ``````<>!!?!!?RsEURa/ca/sCc/oc/ugHHHhIILlNNoPQRRRTEL(TM)ZOhmZBCeeEFMoi 1/3 2/3 1/5 2/5 3/5 4/5 1/6 5/6 1/8 3/8 5/8 7/8 1/IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm<--><-><==><=>-/\*|:~<=>=<<>><<<>>>NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCFSGSRSUSSPDEL_NL(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)(0)-|+++++++++o hPadaAUbaroVpcpAnAuAmAkAKBMBGBcalkcalpFnFuFugmgkgHzkHzMHzGHzTHzulmldlklfmnmummmcmkmmm^2cm^2m^2km^2mm^3cm^3m^3km^3m/sm/s^2PakPaMPaGParadrad/srad/s^2psnsusmspVnVuVmVkVMVpWnWuWmWkWMWa.m.BqcccdC/kgCo.dBGyhaHPinKKKMktlmlnloglxmbmilmolPHp.m.PPMPRsrSvWbfffiflffifflst+___,.;:?!(){}#&*+-<>=\$%@!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     `     `  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ~~~~>>xx(( 8HHHHHIxT, FR  0123456789N4l0x L   ( t   P | $ ?98765432109876543210touppertolowerupperloweralphadigitxdigitspaceprintgraphblankcntrlpunctalnumCPOSIXANSI_X3.4-19680w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code%%& -D&-l&t&|&&&&&&&&&lD&&'(-4'L't'''''($(@(''`(((((((((x)) *-k-jx-k<*,*@*L*P*2|-`Y2X*`*t-h*2,,,(,4,@,d,,,,,-,-4-\--|-W----W----..$.4.@.P.W...[..../ / /214/D/`/-Z Xp//W0W-Z//02000Vd11 1 2$2d2 222222233(3W33133,4H4d4--x4V444545T5x55555566(6<6X66666,77L7h7777777 88,8<8d88888889999tYYY`:68909X9h9|9:(:0:<:p: ;$;4;P;<<@<L<<< =;P======8>T>p>>>>>@? ?T?l?|???@<@X@p@|@@@AAABlAA1A0B?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~pxx|0}@~؀܁px`||0}@~؀܁hW"<0 -bootldrboot`root`|W"<0.bootldrboot`root`X0X00QRY@'6 PRI110hD0|2hD0| u+X+0$,XD,0D"handhelds.org"handhelds.org opensource bootldrdk ،  s@u@v@hy@Td@,k  ,  s@܋u@ȋv@y@s@ TFri Sep 12 15:28:21 BST 20030x L   ( t   P | $   `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??aa atmhLmmmmmmmmmmmnn0N nM0n8nDnPn`nlnn n n n nno|o o4o(oPoDo`oBBloxooooooooooo@Oo o p+?=?+3D>?+(4H?@@A(4X@A@AlAX@HA@AAX@tA@AAX@A@A3X@A@AAX@AtB(4BHBtBlAB|BtBABBtBABBtB3BBtBABCC DClDDLDDEDLFG FdGIDGGIlGXHK(HIxNI(JpOIXJlP8JJ@Q`JJTQJ(K$RKKUK+VL0LWLLWLM ZL