*IsWdbtld /LOONpЏe   xЏU  | p 8ЏE H <0 HO%   0O  x O P D Ol      ɟ Q)A h), \) P) T)00   0 0) 4) T P0\ l^ P M@J`@LHTD?F;P 4 1*t.|h6Q`00L=`H0(2S`100,`! ֟u 'b X    f2 0WAKxElxpv`^@         U  1          J  U  3  P  %  % $ $ $ ( $ $  1 @x40D |D@@!00000000H4 @4$D@@\4 X40!@P`p3Q pP 3 30# #  !`p4Q pP/   0@### @0## # ####  Q00P   1000/    P/**/>?  0123456789ABCDEFSTKP??@MTSTMBK2ENDMPRE$PST$PREZPSTZFLSHUNDFSWI PABTDABTIRQ FIQNUSDDRAM ERRORWKUPSKWUddedeTUrUrUTEEr 0040Q40KK$!"JJrCq EE`4 -L( $1)51@T  1!5& z040@ 0 9 Q000; >0@  01 Pp0@p  01 PX044800 @00  ? -L† @\*l0Phph` \ , 01. 01ƌ\: 00 00(  -L, *$0001#:: 0-L MԠ P I40F40C48@K 5=40P94544244-4`0*4X0'4P0$4H0!4@04804004 4  $0 -L 0( -Lh @T 3L03D03<03T 3$0303,048< -L4 'lHDHPX%XER 232313131313DV iV 913T/13U 1U !1113T T d13\1U <U T1D1H13)U813 ,1313 131U8S 00000]303030P30M3|0J3\(@D0H$LP TX\`dhlpt x| -L4 000 0000I3 00 0-LT @H0P 0S 40  7x00000D -LX T0P0 0R000(00 000 -LMl000 20`3c12c R*80`3c12c#00lS000 0S: p-L @`0,w0Py2 P P "P PP  P P~PT 0D@k2 i2g200` a2 _2 @,000SU20@Vp -L `p \1 0P@0^0;\0S ^&^ ^"\ \ \@"\0@1 \\^  \01V 0;S00 -LBM䠟 P, XO0001 JKPD =gt@P9 t`@02202@aT@# /u00T01101Ru@P  AtPtdeP a00P a00$0tt,1X p-LP`@Q ppMtP @2Sp 0-LMP @0S _K,vK ">K*P,/0 B0S0 -L 00 000000 !0 00 000p0`@0P0S0d10S ,0S d0sP H000S 801  p-L̠ 0@ R, 0u1P00U#0`A@A@0@1p01h0 _1\0$[1P0$0 U1<0(Q1P00Up$ -L$ P 00  -L -L P @`P0000spP0 os + R00S R00@ 1@ 1P`0HsP0  10} T*,0   $ 0-L P@0H(,0 -L∠ !30x0z0l00 ~rR 1 D00!~rRA(0000 048< 0-L ML PQ0@008@KE1$0F0D00A0P@DH0 -L,M < @ 20L0 0Ls0@0D0 T D0S S 0L | 200 0H0 |0HZ00P0 @30\00X0DO0L0PK00S P ,0DB0_L<PTX\`@`d18pKAP~u 00D1)081%0P`VP10`0pA1U00T0 `V`08pK0A0000S00`VP  T0S t0/< RD0QH RP@00@0 D  D Ro,00@  @4dhlptx| -LM< KF,0/$0 /0/ -LMT p`H20 P@2QP42/,2/ 2@0`2/ 2/1/U 1D/X10 10000#01U|10S 1t/1 2p1l/d1 00X4,4KwU ,100 0 01 /@t0/ 0K0B/00>/0,:/000@00 ` T0@00$ -1x0.p00 0S0P1.H1.@10 P810 @C 1 10 003P00 000000@A0.p 0S W0000 00. P P `00 W00R0S @0000 80i.  -LP#x -L P 0F.000S00>. 1 R00 S  6 R00 S Rx0 00 3 R00S  2 R00S R$0 000.0 -L0M @`p00 P0pPT 0 h)p0 P /P000S |0- P$pT .p@000S 40--$0-! $W 0@K 66@0P--P@Kt.-- 0-$ 0-L젟 000@0-00T31i-0-0-0-0-0 -t0-h0- PX0-L0$-@0-0l $(,048<@DHL -L⠠ 00 @Pʌ0D- \.l000S`0\000< T00Q0#S8040 00 0L4PTX\`d 0-L⼠ PPʬ0-0 (.@000S |0-0P`0 3E?6C#::0w-D09-80,000@(00P0\hlp$tx -LqMMl  ' 7   p`hPK@( ,  $'  IP, 3 30 +) 7P0 7  S 2@,,'-)P2o    2d   707 00, 000 Q D2@,,B(P 2G  K}(0'S 1@,,,1f,0 1_, nUX%0G@t1M,$'R `1G,X1,L1,,'$P $1%P1 1-,p$7S w 0$,(\ , 0d 032R 0,7'D0U,0!S:KN~K pG 7S K!./(!P X0`|>wQ 3&,Q p3 ,mPO>K 0C0,  P 0!>C0@!SC*p1 Qd1' , 1 HiP Y1U 1L& n a'`d100S T1;&9&,16&81z&X I'p100S 0#&!&0&0b&,0S KC@P0 'O0&0R&0N& $P% x0VYh0%Wa Px|$|b r -L┡ @Pʄ1% &pd100S T1%%D1 &` 100S 1%%1  &P000S 0% %0U0% %0q P 0%0%t0%  L0u%D0 @0%P$ -LM⨠ P@U0!p, 00=S.S -S h00P X0 00H0  W&`(000S 01%?ltU A&U  :&pU 3&, U ,&xh0O%\0 K%P0G%D0,C%80?%$ , 0 0-L☠ Pʌ0$0 %l000S`0!*X000A$ZZDF<0%40 %(0%0锳 -Lܠ @ T" KT nT KTT K T T K T T0T T l0$d0$\0$P0$D00<$40$(00$@Ȳ -L -L -LQJ@ 0P@?: 00?@ -L( $00 0$H -L(  00 0~$ -L` PT0@ B%40 0S0000 0^$鸰 -L( $0 00S0$8  -L 0 00 0-LMt @Ph0K iT $KT $KT  $K꼯0 0-L@P  h0 -L -L -L⨠ P $P |00 p00 h00 `0 0 D00 800 000 (0 0000Į -LP. -L 0s#ܭ -L 00P鰭 -L 0 000x -L 0 0S0C0D -L䡟 PY1:# R$p100S1 G$`100Sx1  <$@T100SP1Y  /$ 100S 11#1L#1H#0D#0@#X X #X @Dt 00@Dt@Dt 00@Dt@Dt 00@Dt<0# $(,048<@DH -L\M pQZ K  #:0|0K0C{0KzPK`W  #P PV 0-00`V  pW00@f@   gPD0 gP`X .P 0B_S0ܪL00`V  X00@v   rgPPf 000C0 0C0K["W 0-LPP j#@@ c#0 -L| x0 8 P`0 \00cT0P 00H0@0< 000C0,0 PT  -L -L 0"0X p-LX @P`D0 @"80<",08" 04"p\`dh -L, @Y2! "P100S1 "p100S1  "`100S1Y  "h100Sh1d1!\1!P1!D1!81!X X 5X" 2@@P`Fv/ 0R yP @@P`Fv 0R hP @@P`Fv 0R WP <0!鄧 lp,0tx|@DH -LB -Ll h0:! \06!T0 P0D0-! "80p!, ,0k! -L @ @@; 00T -L℠ 0$(, 2b3c13"a#b!!#a 2a3c113a  -L@`bP  -LM⠡ P@, 0 Uʀ1  !p`100ST1" !`4100S,1  !100S1 U !, 000S 0 ^0 Q000 r0 PU@00Sv,(0PU ZP0q PU/00S _@ Dlp,@0S 0V 0 x0 l0 X(H00^PU40; X $0} 4 -Lh P\0" @P  7!0000S 00r頠 -LM PKb 00 KK]  -LM PKb갟00 KKK  p-LMT @PH0`TڇKpb,0 ?K TGKebT GK^bKGK)p p-LM⠠ @P`TGKLb|00 KTڇKAbT0002 T  `,000S 0 GKK p -L0 S*0S: -L┠ @P`qT  | `h000S X0VT  l p(000S 0騝,$ -L䠟 @P`Tp0/T  E 000S0T  8 `d000S\0T  + 0000S,0 0$( -LⰠ P`@pU  p000S p0U  @@000S 40<0ܛ -LMH p, 00 040 P80 @T_aP@T P0v00 `@TPAaGa` c`@T00F `<40S 0 S S =S080 40S a0BS0A0BS000B S00S 040 80S a0BS0A0BS000B S00S40S 0=S 00`Pi`@`@@U: `0 S S 0 S S000 S S , `0` t -LM Pp@`Q% B.Kꤘ000eS*0 S S00X0BKH0 0 S S0 S S WBKS0eS:$ -L P  E -L⸠ |0*y0%v0 s|0pl0m\0jL0 g<0R,0頗   p-LMP @PD00 `TڇKD`$0TGK;`ꨖ$X00 KGKK P@T 0 S `^@T p -L̠ @`0 pPPp0cU`ʄ0]Ut0XVd0SQT0NL0  ,0Е (,048<@ -L @0R  0Ss Q0SECEC -L 0-L@P P PTP00 -L @+T0 0Q 08, 0R 0 .(Q @0$00 0S S SL0 P ,0btldD HLPT p-Lܡ P@10 0S 1000 p Q*pQ10 0S% taQ l1d1@Qq D141,1@:QQ) 11 `Q 00@@`Q 00@:PQ 00@000 80<0\0:pX\`d!hlptECECx&|\ -L 000| -L -Lt p0@l0 O 0S T0000@ @000040000$08 0-LM℠ @|0000 Pl0 PT000SH0  @(000S 0ꌏxKz8000$0000  x0 -LMⴠ p KP``KK@P  `Pd0S h0l@X0L0@0h a@ 0x p-L⼠ `P0_A1P0T0U@`P`P`Pt46SX0E0S`!0SP,09$06p锍$ -La0@SA0@S0@ P -L 00Q\ -LH @@000S (00 \ -L8 40P 000 0鴋\ 0-LH @P<0P 0$000 00\\ p-LP @P`@0P p(000 0 p\ -L8 40P 000 0 鄊\ -L@ @80yP  000 0,\ 0-LH @P<0`P 0$000 00̉\ p-LP @P`@0EP p(000 0 pd\ 0-L| x000Pl000S U@+P0,0##3!"cb0000td -LD Q,0 (0000MP 0-L 000P@T T U Uh`UPPT T UU00U -L␠ 000@th`UP@8,0U) &#0U -LU -L@ `4100P%Q$q!@0S 1z1000UpG@T WWt0MP0\080@0 00-1 U -L 000騄 -L -LMH A8100P P(q8#H h P 10 E0A000:06020@ UU !h,@ pG@HP WW !\0-1 \0T0 D0!40!,0 0! 0-L@P!vP%q0 -LpBaP@@TP  -LpBaP@@TP  -Lؠ P`UUpPE@t UUX0=P00H0~<0z00v錁-1U $ -L@ P8r8200`&a $200R2001S 101 R01S1@0R 1>1:100S 1@ UU  UU00 LUIFCU@0=pGS@t WW0|000t0h0\0P0|-10(,04U8$< -Lܠ 00 Pp0000001Wp!`000V*0001@T00U0S X0P T*P`0V:},0(@ -L 04|D p-L 1(P 100S 0`A00P1S0P000S 0`A00P1Sp0h00P P H0 D0p40p|HLPTX\\`d -Lx pp100S@\100S H1`QZYP% @1S@100S 1`QGYP @1S00000S000@00P00t00h0 10\  0C0L0y,0vP{LXhlpt\(,0x -Ll 3`000SP0WP<0 ,00 0c0y\| -LĠ 00 R000@0S$ 8s0Ddn0pid00 0SSp P<000 0 '0Rx\ -L∠ p000S P0U\0`101@XP P00Ux -Lp h000S 0PD000(@,101 0 R! Q`w -L M , 00 2@0S P1110 1000x p1000@CTl1040 40`10Q(00X*10p@DTW00 1010p00 0000W U0R [Z WP W  xX00 ,0$000(0 D00 0SS00000h7C vptld0000h$0 -LX p`L100S<1 P1000U1@0WP`P00UV00P0000U0`@ $LP0UH08000 00C0`t -LH D0p`Ph@jT PUr -LM P 33332 2n2P 2p2{y2vt`qPp 200S t2A0S0S  1SWE<20p42S,2P6 2LP/1o2D0A1>1p1@ 1P10!`0C01r1n1j1f1b;`P, P1TD1P(%8"S (1 001D1@1 00 00S 0@ 0S0S 00S000S%01prXxLp(,0\,0S 00@$0008< F<; \ -LM⨠ p` `FP000U|0000 l00,0 0 0AT0#03T03S  P, 0Udn(, -L -L -LP L000S S 0 0xm -L\ T000S S  0 0tm -Lt p000S S T00 8#881400 00 0Nl -Lp @h000S S L000A 800 0@0 0*k -L† @Ul000S S P00 0800 00 0`k  -L| t000S S X00 8#880400 00 0j$ -L$ 00 0 00j -L 000!i -L 000i -L 000li -L 000K0C1P !P0088 ` 8088$ 0  -L4 0 00000'L -L⼠ @P0 00 pgT0MP |0H  T0MPa @5S  R(00 \L $~( -L M Mx @`l00 T@D0 8K^KpM@$>K0C46pP (0  0 %dK,040$ t0 K d0 T@>K1@T@001@01`0$0$)08<@D -LM M† , 0 Pp00 8 T000SH0 0( < $000S 0g {JHLP10 `10 p10 10 10 048 10 PU NK@D1LLWVYX48S< NK@DL1LV<1~LNK@D(1xLW1sLNK@D0mLX0hLNK@D0bLY0]LNK@D0WL4Q0QLK@|0LL>K0C,0 1,0 10000@08<(0L\  $ -L  -L \ 8 0) 0  \  -L☠ 000 S X0 L0H0D0@0<0804000 FTX\`dhlptx -LP HH0@D4   "0Q01PF!| p-L `0`000S 0 00000p00@0P@D0PTT`000S T0 00080 00p0000`pET -L⸠ @p`@@T |0P00`000@T@H000T 40P0`@0TxD -L蠟 @pP@@Tʬ00`0E4#01T#000@T@l000TP0pP0`0E4#01T#@0T%C| -LM⤣ p4 0 30304x30p30h3 d30 , X30P3P00D30<30430,3@rJ`J P`30S280 P< 00@0 20D0 200S Y Y,0  0 0S |2J, 000S< @ ^JP  @0WJ @ D0S =Y+4  4 0S 1,, Qz 0S < @0JP  @0)J @ D0S CY!8 @0S0D0f,  , 0S <0@JP  @ I @0 0Srdp000S`0+Y1T00@0#BJ]TP0H00<04yw0D0<0@80,00 04 -Ll h00\00T0 00H00@0<0$01Q= -Lp h0 d0@0I000S0080 40 0R 0 000(= -L␠ 000Sp0 0@0SX0000D0D00 0R$0 000< -LⰠ 000S0 00 0R p0  d000R00D0 @00 0R00(0 000; -Lx t00 l000@T@T P0p@0`<0P40@0T@0T: -LP`pQ 0R 00C Rg000Q 0@lT  D4K0p~000@T J@T0pn000 -LMp`P @At  0@Dt -LMԣ `080 40 pZW4 W [R/ KpQ40KH000K!A0BS p p p p p 0K 40KH00 80Kp#R R R@ R( R_ R R*  Ro R R R1 R R R W0 Kp2p80S 800C80 S8 40R*80080 80S 800C80 @@80T:@ @40T:@{@40T:040 80 84P*@`@T  DJ8 a_0@DSU8 40R*@ S@40T:L @D80R#804u)80S <800C80 S8 40Ru*@ 0@40T:9' @D80R8040 a8P^ 40@`0@80  I89 0@DS400C40 BpRPU680S 800C80 S8 40R*@ @40T: @D80R8040 GG4 80S *c4080 `00 8 K40KA R RP04004 000S!S {0 0000 0-LM8 P ,0@0S:00Kd20 -L -L -L -L -L -L -L -L -L -L⼠ 0 1R @QQ 0Aq  R  R Q1 -L0 4 8  -LMԠ Pp@`00 K0d` ;#;`S0#8#8`St0K`KAd0S P000@0lT40hPl0hS0  0-Ll P@080q!L00 0D00$040 80J@Q 0$0/ $( -L@  -Lؠ @`Pp `P0S J@Q 000 8 b J80pc@0S[<8P 40,0<wL0/,048 -L8 00 1R Q,. -LM̠ p KsPd`KK@P  HPh0S x0pd0\0P0l I@00lT-<@DHL -L @P0@00T1*P0` '%@T:0EP  ? R00S RPPT0@P00T*D`<0pEP @T:,PTX\ -Lt `Pd0X0@T00T*HP@0p BFP @T:+`PTX p-L` PX0@T00T*D0`UEP0Sp@T:p$+PT -L| P`p0@l00T*\0p0S 1EP,EP@T:*PT p-L` PX0@T00T*D0`0S  EPp@T:p*PT p-L⠡ `P@1 ? R00S R 1`1DP  ? R00S R $1DP1;pV@T_@T 0S  0 ap0x0p@PX0 H0@@00000p)\dhlpX -L(0  -L(0 -L(0 8 -L Q Q Q( 0 0( L40(0( 00( 0C 0,, -L( -L1S ( 0 (0 -L( 0 -L\ X0 P00R <0 8000(0@0  0 !&t -L 1S   -L P`@pRp1 00@DV PfpW T_p T00 `@`@T P00@H00 X00R0S $0yX@%x| -L 0 0$ -L 0  \$ -LMⴠ @P, `R`0p00pV h 00g, S U P p ' P@ $xP@T L00@D00 Y00R0S 0Y@x| -L 0  " p-L`P@R @T 0Sp -LM✠ Pp`Q! 000S /CW 1 !0@KEP0 !C /00 /0C0 8" 0-LP@C 0 -L@ -L$0S  -L 0S  -L 00  -L 00  -LM@ 8000S K00K00K vh  00| -L 00 -L  00 R -L$  00 #| -L 00r< -L  00  0-L M4 P$@K  00 0-L Md P$@K D040 ~0p0 -L M@K jr -L M@K! ]e -LM@K PX -LM @KM 0-LM0P$@K A@T* @T:$K60 p-LMx Q d`,@K`0P!1 10A0 0R\, KL 00\00̘00000C0p -L| `pPA@Dd0000S T0 0R 00W4000@D R00 0-Lؠ P00 R) 0@\0RP \00 xR oR 00B0 S a0BS0A0BS00000S00  R0x -L␠ `0P00U*t0pBA@ AP0SPU:,00~ 0-L∠ P@|0mkl0`0 \00 80<0 @0R 00\ptld -LMMl , \1=T1 P10 80@<0@`p (1R% 1*1n0! !0e00 00P0U 10100 QP0U@I,@T* R 0S 0S @T*0 S@1B^KPE $\ptld0bS00T *0S S S@ 0 S S@00B^KPEH080YT*0S S p-L` `@P0PV @0 @PQ VPPp -LMM8 @P,1()`0d PO )T0 j@P0 B~KpG@0)4K ` BK A0(P0a/)4[ S S )4[0@V:B^KPE00(4[S T0 >@P @@04S 00A? 0<(V: -L p-L☠ 0"0`0d|0x0P^l0Z`000e@BDHADA@0M 5Bp -L `PpX0p?@0000S T P@ A  0S  0-L( @P00 p-LM␠ `P00@AKFK@ ABKK@ AG/K?KV![R $004 $ AK A \ GKKp -LM젟 p< 0`0]00VC*Ȁ8KPW @T <0>PP@TPU) x0B@0S :SP07  40/ -+ ,0 `00V:$ -L0S 0S 0S >P 0S 0S   0 S -LM4Md PiK(`F0)K\0D2p@200\)@$200A@A@ A`U% - R00S  n R00S @R1 11111 9K\ h10WE*\QKHIIKX@DP5 02,1==1=0S :S= Q == > = 0=  ^=x0=pP00W:Y9K\0S @0R(,048<@DH= 0& -LH @0w8000S 0" LPT -L 000S: -L1`20`1` -L -L -L -L 0 X -L( $ 000000 \ -L -L 0"L ` 0-L∡ P@x1Z=PU`1 D 00001E=PU1  00000=P 00%=PUʰ0  0000=PUh0p0 @ 0000 dhlp tx| 0-L@ @@t 0P52@Dt0H  -LH 0:0<@0:0( 0:00:0  -LT 0:0H@0:00:0 0@JmT  -L@d 0:00:0T < 0:00@0:070:07  p-LP@`@Tp 0-L@P@PU0 0-L$ @0P@T0$ -L0 ,0@0Sr00 0-L@ 80@,0P7@T00 -L?@`?@0P -LMࣟ @Pl! 3ZK,>A 弓弃sc "!! 01 "SI* hK 011 Rp t xq |a 0 00h 0h!0㜈0 00d 0d!0cj 0 00` 0`!0w0 00\ 0\!0c0 00X 0X!0㜈0 00T 0T!0cj 0 00P 0P!0w0 00LP0L!0c0 00H 0H!0㜈0 00D 0D!0cj 0 00@ 0@!0w0 00< 0$`K @!@K5H0 %/80-h$0', -L 00d p-L`P@   00 R   00 Rp p-L☠ @PPPPp0` 0 ?0P%@ 0! 00 \ 0000000100p -Lp`P 0" 0@" 0 "0R 0!U0$U0"TU^UP(T\&P 0 P,00S0 P,00S0 ,00S1.00Q 00T 00@R 00 S 000000 -Lp@@`PWp" T00 R0S LDP0 T00 R0S  TLD000LDP00000000xt t@x H400 H800pW' W$ `W" W W W 0Sp00 0@  0S, P  0-L@P}p 0 0@ 00 -LM⠣ P@4  0S 8 $ 8 0l# q0S 80 `0\* 0\:`8 R4X  40\<0 \(0X Y <0K0K ! 00\0 S Y< -K0K ! 00\ 80S X0Y 8 \ <0 \ 0\* <0 0\: 40$0S|C\0\s* <0 000\:j  <0 000\:0K0K ! 00\0 SN  <0 000\:-K0K ! 00\4  <0 000\:0K0K ! 00\  <0 000\:0K0K ! 00\0 0\: 0 W 40 \< 0S/ \0S 0\=* 0S\:3X008 R0S+ 0Y($00CS 0 S00 00\:\0K 1 0R\ -L M -L4M┢ @< @0 0L P @PT SX $ X  P20!\ <0 0R0@040 A D p H  43<0Y*Y 0S, P DQ< 0iS0 `*8`Q800T0 L @X RN;:TG000@T@000@T0K0 S3 H0T000@HT0K0 S T000@T -K T000@T0K@ L0 00T0@0T:X R< @8 K\1L0T00@T8K0 K R 0LL T LL P0pP  X0Q0 R0S  5K- K R T0LLL P 0p P D0S<0iS*D@< Y0#03T0S 0 0@< Y0#03T0S00D0 <Y:@ P0S -Lp @P40QC` 0QP 0@T*00 000C `R,@T: -L M -LM`(0 0 4 @P 0Ri40Q3,0 00Cpp 000N 4 PK*W 4 a0R: 0<0@@ W*0W *804   @ Q*0Q:80<0Q @0 00 00, 0000 @00 , 0X4  4 p,00,0 R:4( -LMP`(0 @@40Qp( 0R[p 0004 D0S0D0 0Q 0 QQ* 00Q:0Q* 0 0Q: 0  (`P 0Q* 0SQ:  -LMD P`@@ 00C 00C 0RV401s &p 000= V; 10,0 P 0, 0S00S*`` 0 0 00SD R 0RD` 0c p00SS000X0 p-L⼢ P@`,0S0,0200200@D@ 0 00@ L200S= 82000Q000T,0S0 000 0 0 20, 00S  00<0>C00C401B1>1 t1 01S<(0$0S0 S0$0 <(00S 0S 0S 0$0 0000000@0@0S 00000C000$000(0x00,0p0000h0040`0080X00<0pp$  -L⸠ @P# 0 00x0 00d0 00 P0 00<0 00(0 000 0000 @ -L⸠ @P# 0 00x0 00d0 00 P0 00<0 00(0 0 00 00004@ -L 0pD@ (0 (0@H` (0P (@@0`8`00@0D$!  l000 ,@P8`L00@0D$  4000 ,\ $(,048< -L -L4 P,0,0@(0mP @ p-LM `P@ (0 $  000 00 T* (0K0 ,0K,P l0d0 0PT@c *@040@긪DHLPTX\`d 0hp -L w2S222H`@01@T:2>P@@T *1S 2yt2uPdU\2'P@@T *1S $2b2^PdU2@T*01@T:1P@@T *1s 1@1<PdUx1P@@T *1s @1)41%PdU$1@T*A@T:0P@@T*1S 000PdU0P@@T*1S P0T040PdUdlptx| -LT @`HpPD0T  P0P$ -L@ P40@ 0 0鬥 -LMⰣ @`Kd X&sTi3#Px3K00#40@KᇯD30#$ #805 s R00S  t R00S  d R00S R2K00#40@KT|20#40H2#P 42#P  2}#Pj2w#P1K00 @K1h#P11n#PKj @P@1X#P1|1^#t1Kd1 O ` 0? PP,1 1K00#$ #80@K PK"0" {"0}0zˮ0 #P40K00#40VH1"P |1KT+ʄKT1.L1"P <1K! 1"P1K00T :v"PK0e"Kb"K0]"K_80 0K "$ @Kt0M"J"\0F"T0D0@ ,0$000 $( -LM M4 ` p30Y 0 R00S R Y 1 R00S RI`YU2/"Pd2&"PD2"P$2"P|2 "PRt1"P10j1!P 1@1/ Z1!PP1 00I`d1DXX1) YFH1!P81};$1!P1 r01!PAP`0@0U*?K0 >K0C8C2[S 0TNP` 0@0T:d0BX0,048<@DHLPTX\`dhlptx3v!P4Y2 P 0/K  >K 0C8C2[S220C2K 0OK@ >K 0C< 0@ >K 0C8C2[S424,2;!P4Y2 P?K0 ==K8C2[S1r10C2KTOK@ ==K<@ ==K8C2[Sd1X `1C[rL1!P  ] @ $1\Y s Y  l ?S02 C Q0%+*/?R0&0;0601_ 0/K  ==K0C8C2[S L0f|X3 H3/b?b3`e $P 20W2+(2&MK,"8K "w@ 0T*$?K080K000!!,==K0C4P@ T:r@ 0T"*$?K080K000!!,==K0C0Pp/KpW0S 1@ T:`Vx1PUU`1kX1 P)P`@1x@0U*?K0 ==K0C8C2[S 0TP`L0T:000P 0I@0W * $Pp 0@0T:W D0pY|P3@Pv@3p0Wh*=mK `FP?K0,0(?K0 0( PC2[S 2T8LD 0@=C2[S |2T)PpUL_ /K?0TL?0L? L?S0S 2PpUL_ 0TL?0L? L/Rʎ?K0S 1pL0T:W 11x16P&@ P@T1Y @Y  PT a $P @T{0  P0? 0TY Q0H /@Dt0h0$$P @01  $(,048MK@D,?!@30003K00#$ #803fP?U=K0C0,>K,P 2S;#;S2KPU2CP/U#=K0C0,>K(P@mK`F}KpG, 0R@T;#;S2P?U11f P$Y 1 ?K0/,>K0C(P|1x1plA1(0CpWڭD1; PRY 1K!. p ?KppWڎ?K0?,>K0C,P 0|!=K0C0/,>K0C(P|0VpOK!]KPE8 0R=pWH0H<@DHLPTX\`dhlptx|$3PbpP Y39P $p(0 2  2WxWD nKU 6 ?0UDD?KH00,>K 0C0P `2X2XP8S 82UM$2PI?0? L8S 1U;1L7 \|W1-1y P0Y 1NK@DU ?K00/,>K0P 1p$A(0APSpW1h0d0B P8Y 0OKU @/ >K0C8Pt0tpT@(0A SpWڈ|2 P(Y K kD2p W p (0B#CpWڒ?K0? >K0C<P11'1 P3YQ I`K!.:K 6p|A W >(0ACpWL1_?K0?K000/,>K 0C4P000 P=Y 0=?K0"=K0C000?,>K0Ph0d0pl@1(0C"pWpHP"MK@DpWdh`l 3V PhY 2K!.K p"?KppW0H2K0G2K0E2K?K0?K000/,>K0C4P \2>K0C0>K0C000?,>K0C0P2^pOK^KPE 0REpWp_KNK@D 0R 111pWY1 PYd Y  ]D1/ $P; 11P+| 0?   p 04?   Y0P  / I`Yڠ0PI`Y$P $p 0? (0 X0T0D0t8Qz 0/ / pWK >K 0C0 >K0C8P*[0P*[<T*[8X*[4\ P :[S$?'3R 0 pc:[S $?'P3R / <000,>K0C0?!>? |?!>|?  |GW2||/R Y @P 2~ |2~2]2r2o|Pqh2Pd2NE T200<0/R@2C*<2XY,2S Q2N PP | 1| |?|?P 1!10S11| |?S1 P  |1 |OK AP\1 X1.K B|/8132R(1$111F1B $P00/?d0|0|?!S:ўKI~KpGQ( K @!.!P" |0  $(\,048<@DHLPTX>\`dhl8ptxQ l2Q X202kP>K0C0 >=K8P}/?[S 1/`1Dp<000,>=K0C4<0,>=K0C0P 0R `1gX1L1@0Ub0a$11@0TQP U/!>Q / |?!>C|? `!SW*0!0};0x0t0p.0kt0gh0c!X0T0|LT0 0 -L Br 00 -L 0 00{ -LD P@82`p020U$20S 2P#1[Pw s R00S  m R00S R 1FP 1 R00S RpW @P  @pP <1,1@P }$ yHT0 40S Ep4p@ 00>000000000 000$000(0|00,0Pd0R00D0Id{ -L$ TP0=x 0-L8 P01@:wP @0000@P0 0/S0000S/ '0000 . R00S R . R00S  . R00S R@ P P0S@ P0T /3P0x -LZMȢ @KA 00Kc pP 0@0/S K2cKpP P0ST0T`V PFW P% !?x-ulrdn=k chbesb1~0@ -rY-wU  @SsO@-xJ -rF-wB  Ss<-x7-r3-w/-x+8< 0>bOK,O7X p02 /\0,`T0VyD0%<0  0 8w  0 -LhMpKt tK0P t 0-Ll P@P P"@P 80(0000s $ p-LlMh 0`P@K@ nKP P)0PP0Hs(p p-Lp `P@PT0p 0Pp0pr(, -LPp|`PW00@XX:UaPU  0@W@ -L  -L^ -L -LJ -LM࢟ @PT232PZC l R00S  s R00S RTh2Z- c R00S  a R00S  t R00S R:T6ڈ@K`PP1 1P1@K 0 P`0[ S Sl1 [ 0B R_S?[V,1,1$1qPT A  $">K<P0 0 2S0 0 0 00KP+Tt@KOx0 Ph0 KPT0T0<0Dq048<@DHLPTX\`dhl c R00S  p R00S pRAT=pUOKnoKK  @P& P(1\Z1 0P 0L0IOKF0C P00#08nK600 r R00S  m R00S RT"PD0D0@00ptx|\0 0 -L 00k -L  -L  -LD @ Q|<0|< 0 k -L4M `X P R S R8pKp0S7X 0$\ XUD 30PR -L䠟 `0SX*p(B pA0W @T ~PP 00 P@Tpp PUW0G0083@a0S eQpGUW` -LM`80 PQ4 q X) p41S  R 0SP 40 H81PU A4 K040pG0?U0SUFXCp04 R6 802<0 3C 3X,PK 00K,< 00SP@T 3Y0(0SX  $(00C(0\ 00C00 4 pG0WS  -LM⌠ p,0 `Q7 X PAQ  H,1P 00PE0?Y0SY]XP0 R 0@ b80! 0000 PUZ 0-Lp @  P0SP(0S``P1 0`\ 00000\ -LM( pPQ @aQW ( GT001S@T0X0Y0S (hP p-LP@` R 0 0S  1S RP0 000C0C`0S0&0Sp p-LȠ `PQpᠼ@Pp0EQ 111 d000Q111h H h@l00l0d00d0P @p00pp[ 0-LP@h0Sdh0S @0h0l00Cl0d P0$00P0000000000 P  0 0-L@P P 00000P@0$00 -L \ 00  ,0S  0b01|  B  0-L@Ph00h@l00l00 -L@p0S p0Qp00p0S0h0l0 -L0p0h0l0|01 t00t0x001Q 0-L䠟 P@0|00S   b 01S@Q00 \0SQl0|00S   b 01S@Q00 \0S0W?B p-L@01`t0P t R 01t0R $0S R^ p -L, R000 c !0t0|000 -LQ000c01 t t00R 01t0R B,0S R -L`PpQp@P 00000,pPP0H0D0@0U 0T0X0\0`T0T00 p-L@`PQP p 0-LP@P 0S P0 -LMp`(0 @ PPC @P< 0$0000Pp(000HPDP@P0L00800<0(P0@00p 00W T T,0X0 0 0  P;@ -LM@ 0 00 00  0 -LM@ 0 00 00  0 -LM@ 0 00 0  0n -LM@ 0 00 0  0Y p-LMP`p @00 00 FPp -L@` PQPp0<UP0SppRW PP0S 0@00 W 000 HP 0-L@P P 0  000 0-L| @|P001 t t00R 01t00 R01^@Q00P p-L@P0H0aʹ800S01@0<80S P  @0<pp 0-L@8P8P<2[#200>"[00 ">"K K<0<K 0+ P@246S$ J@0s D"p0W -L D?0R$$o`?0V44`@T 80Q 00Q(00C(0 @DTY O@WDD@,00, 0TpT+ -L"P0S S TT 0-L@P0@ U0D0 00 -L@|$ t 0-LT @0  P40S000 <0<03 -L@(0S0P  0S00 <0<q`0`0 -LT T0S -L@Tò -L 0 0 -LP0S z p-LM`P0S30Q PA 0 00  00FOK,b 0POP0S Rp -LP 0   -LM@P0,`Kpp 0D'[P 0p 08'[ P -L#M$ `L  0 XO a80!P" a@ <01 0P00 H" P0H2 D  HP00\ 0 S -KT" D员)8@K00  0 -K4[Pt<0t<T04?7"SDPH D00D0 H" HD2L00D0lt,0t<@246S-  b@<02 D"Q !010P0 00T"? C@@ 0@2$& BT0#3$X0SX 5T 5  b@<02 D"Q !010P0 00OK  0}p ]K?8" @0  0#20  R $ 000/  T04?70CS000P0 1001801<01@01D0 1H01L0$G0D000P0 1001801<01@01D0 1H01L0$ 000 PP0S0P0T0T00o<U000<06S@ 0 0 0S @P@ LP 0aS@-pP`@":R0`0 S`c 0 R0&!0@P`V  0 R0&!RP@0 S`c 0u R0d&!0@cPc` V 0u R0d&!0R BR  BR  BR BR B  bR@-`pP@0`0 S`c 0 R0&!0@P` V 0 R0&!D0S0DXl0@A  R0 000 00000@ B@A 0@A @ A 0 @A @ 0p@-A  `dR(8L@ @A624\ P 0 6>40654 06>406>40pP@PL @0S,@ThA0@  R 0 A0000 0 00 A0@$A @ B A@ A 0 @ A@ A0@ A@ 00@-A0 PdS,@X A@ 5>4 R0A@ 5<4 05>405<405<4 00A @A@ BA @ -L@Q  T,00@D0 0 ! 0 !0 0 ! 0 !0 0 ! 0 !0 0 ! 1T #T (000 0!@T "p -L 0 P p-L`@R  80S01RPPU pTp 0PS1 (P $0S1 $ (  PpP0V P`f 0 00FSP $0S P ($P0` 0S0 &LP0UPT P $0S P h($PT Q    0S000)p  -Lᄣ@P  0S 0SXp0  R. 5Rcu0S0Cp0    0S " 00 0C00 #20Sl2 000S 0C0 0P  `p0P 2 00000S p0C0   0 <0 000S 0C0    0p80 000S 0C0    0p40 000S 0C0    000 00 0 00 0C0 pw 00 0C0=WpWP  D 0pS 00,000S9 p0C0   0 <0 000S' 0C0    0p80 000S 0C0    0p40 000S 0C0    000 pR <0  00 00 p-LL@P   Rp0 S 00 0C0\p0`PQ0 0R Ra\  Q00Q0e 00 pTP` Q    0S000 0P`0p -L@P P $0SP ($00 -L`@pPP 0S 0S  00P  0 04 3@C d`  00 -LP  R@@@@ 0S000   -L0 h -LP P Pl -Lp`(@  @P(Z. PU$P($(  PU(P($$W0,08p 4P0P  <0 -L`̣LML P  PT 40 pX0 00X ^*0nC,0Xa0 S񏐕jnW T R  P0L0 0 BT pWP @ 0 SJ +.ꨁpG@8pd00,K0K4 K80K``,04 80=P pT00P0l 00X0 YꨁpG0ꨁpG0ꨁ"pG 00 pTP00P0l 00X0 9W T^ P L 0NT pWP t1((0R d! 00 pT00P0l 00X0 pR 0S000T^ pL P00P0l 00X0YK,X^ 00( S X R*0bCX bY9L X0404X 00L ^*0nC,\,0XaX R 00( S X R*0bCX0cY pTL P00P0l 00X0L X@T PT@! T @! oP0TX0dP0 T X 0 d0dS00S00 W T R( P0L0 0 BT p WP I$I R@2P# 00 pT00P0l 00X0 R(  P  pTP00P0l 00X0 7(pG0 0 0 #50R *2WTQ L PT 0 BT pWP ⨁ pG0  #50R:@P |10 P000` $0 @P L@ t( $ 00 pL T00P0l 00X00@0@20<0  Q\@ ` *@W *T^ P L 0NT pWP :H0! @Y 80 pd00Z YI  0W* T0Su L P0pP TWAT :8pdpl\@" , 1 080`0Q\00YQ ( $# 00 pT00P0l 00X0 VY 0`1 0^ @20<0  Q\@ ` u:<0K   @ @ K< @DK H K` $  R@P t( $ pT00P0l 00X0 `<@D H0P pTP00P0l 00X0 ( $ pL T00P0l 00X040L P L L P  T 40 X0 00Xp^*0nC,0Xa0S@ 00L X0404X 00L ^0 40R pL T00P0l 00X000 pTP00P0l 00X0 pTP00P0l 00X0 v pTL P00P0l 00X0d pTL P00P0l 00X0S pTL P00P0l 00X0B pTL P00P0l 00X01 pTL P00P0l 00X0 pTL P00P0l 00X0 pTP00P0l 00X0 40 0-L@PR<0000CS( $0S 8(0\4000   <00 p-L@P0`0CS( $0S`` `8(0\4000   <0(($($$($p 0-L@P(v(0040000 -LP -Ld`KAM 0 p0  d0 `0 \0 X0 T0 P0 L0 H0 D0 @0 <0 80 40 00 ,0 (0 1 !1 0^00d0SP`0 (S  Q1S 0 S01\0  ^ 1S 01 1 X!Q * 1\ JQ : 0Q Z` K! K^qK0 0  0 qc 0^  !Q!  !000^:  00  ! pP p a q1 1 Iy  $  `R^0 qp$ 0hQ!  h$   0 P(! 0@i1  1Q *Qc  Q*0P(!  0ZSyP !K 0 !<D 0@1 `0B!> 0bQa!0 0`S`I 1pQG*!1!00 qQ: ..8q$0C $ 0q@ Bc80C$ !0Sy<\ ) QR -L P@pt M` 0 ,P ( P"  00 p0,0K00]@t0 t 0 0S 0 @ ( $ -L`L $M0 P4 , (  pPY 40!0@ 0 0,Kp@@P0St0 9t8 034 00 00@00 0 0p@@P  @V00R0S t40 t $0  $(,048t 0 @ ($< p-L@@@@ P`(( @`@p@DHL -LPȣM, @0  4 p400`^*0nC,0nx3080 0 S<{@834\ Q) p00 000 b004 00O, 0 040 400p^*0nC,0n,Q Q 0000 0 W*4 Rz 0 0,0 0p0 4 W B4 :8 101 08pbS 00  00 00 @X  00! 00 p40 oW*4 RB 0 0,0 0p0 4 W B4 :80!000pa 800  W*4 R* 0 0,0 0p0 4 W B4 :8 101 08pb 00 00 7@ 001008  00 p40  PTW*4 R 0 0,0 0p0 4 W B4 :8 pa1 08 0( cY*,0bY:P> \/,^ 00( S ^*0nCn\, 4400, ^*0nC,,0n^ 00( S ^*0nCn\ 0, 0, LY(00CS000\7,^ 00( S ^*0nCn\', 4400, ^*0nC,,0n^ 00( S ^*0nCn\ p, 40l, 0L0rWpG4 00 0C4 00 , 4400, ^0 40R p, 4``0000`0l 0F00 p40 6 p40 . p, 40& p, 40 p, 40 p, 40 p, 40 p40 00`0l 0`04  -Lp@P`(  P 00p@P` -L 0($ -L`p0P4 U@e,0@e0 T@!0d 0y00T0S 8\ <  <0 , PU$40(PS4P4 0@eT@!0d0y00T0 S  8\ <  <0 P 0P -Lt$M` P4p0@ , 00 W* 0g0C 1 PfQ!AD a,00g40 "0H0 8 < 0`FT@T8,01\4 A5R4 0@b0H05S@c  @lT 1 05\0`FT@T< 0H01@ " D 05S@cB  T4 0aL ( *0`FT@ T:@ 1@l4 L05\0c^*,0b ^:n Q l0\0(0Q0g00 A 0Q0]00 A 0Q0S@@ 10 D0f P1Q!`AD@ a`0 b004pN@ 10\l40@5S4  @c 4 X . 1fQ!D AD0 a0 P@ 0 b000``4p\p 4 V00\P&1 fQ!`AD P@ a`0 b004p -L0pQ (M( e(0S` 1(`(V`!fV( E`F0    L @PL0 , 0 00V4 8 < @ D  H ,p  480  <@0  DH0  V 0`V 0 (^FLASH_BASE= Evacuating 1MB of Flash to DRAM at: done Make DRAM section cacheable: Map Flash virtual section to DRAM at: , Rev - for Balloon [BIG_KERNEL] [MD5] [NAND] [YAFFS] [MONO] >> Last link date: Contact: bootldr@handhelds.org Contact (Balloon): balloon@toby-churchill.org >> Last link date: >> Contact: bootldr@handhelds.org Cpu company: DEC Cpu Architecture: StrongArm Cpu Part: SA110 Cpu Part: SA1100 Unknown Part: Unknown Architecture: Cpu company: INTEL Cpu Part: SA1110 Cpu Architecture: XScale Cpu Part: PXA250 (Cotulla) CPU made by unknown Company: revision A0 revision B0 revision B1 revision B2 revision B4 processor ID: >> ARM Processor Rev=>> (c) 2000-2001 Compaq Computer Corporation, provided with NO WARRANTY under the terms of the GNU General Public License. >> See http://www.handhelds.org/bootldr/ for full license and sourcesPress Return to start the OS now, any other key for monitor menu Rebooting...parseargs: argc= haystack = <> needle = < helpboot> quitACK0 partition -- displays the partitionspartitionpartition show -- displays the partitionsshowpartition save -- same as params savesavepartition delete -- deletes a partitiondeletepartition reset -- resets all partitions to the defaultresetpartition define -- flags: 16 for JFFS2, 2 for bootldr, 8 for rest-of-flashdefinenpartitions= base: size: end: flags: usage: partition delete part_name usage: partition define flags 16 for JFFS2 Error allocating space for name +basestr is "+" jffs2 bootldr sector must have flags set to 2 bootboot command failed, entering monitor Probing bank0 memory size... bank0 memory size=0x in megs: M MDCNFG=dram_size_ptr=Probing memory size bank= dram[0]=seems to be no dram in bank= mem_size=[i] mem_saves[i]=maybe mem_size=found= mem_size[i]= memory size=probe_ram -- probe for ram size and banksprobe_ramn_banks=dram_sizes[0]=dram_sizes[1]=&_start=FLASH_BASE=boot_flags_ptr=*boot_flags_ptr=boot_flags= enabling mmu setting flashword=probing ram DRAM size probe failed! SDRAM size: params loadDEBUG BOOT: not evaluating params DEBUG BOOT: use `params eval' to evaluate parameters. ** NO MACHINE ID **. Refusing to autoboot type "?" or "help" for help. flash_type [type] -- print available flash types or set the flash typeflash_typeflash_width [16|32] -- print available flash width or set the flash widthflash_widthflash_width=32 16 1632Invalid width: must be 16 or 32 md5sum md5summd5sum file [partition_name]fileUsage: md5sum file [] Usage: md5sum [] Usage: md5sum
[] rooterror parsing base addr: error parsing size: display display -- dumps the SA1100 registersdisplay SA1100 Registers: UART: UTCR0 0x00 UTCR1 0x04 UTCR2 0x08 UTCR3 0x0c UTDR 0x10 UTSR0 0x14 UTSR0+4 0x18 UTSR0+8 0x1c UTSR1 0x20 load flash -- xmodem receive to flash (see override param)flashloadusage: load flash error parsing flash_dest That is bootloader space! Use load bootldr. Operation canceled load ram ramusage: load ram error parsing img_dest bytes loaded to NAND chip not detected uncompressing gzipped bootldr bad unzip of gzipped bootldr Not loading invalid bootldr into flash Looks like a gzipped image, let's verify it... invalid gzip image. Sorry... img_size is too large for region: programming flash... unlocking boot sector of flash erasing ... Erasing NAND region Erasing from 0xErasing bytes 0xnand: erase error! erase error! writing flash.. Programming NAND region Image must be a multiple of 512+16 bytes for yaffs partition YAFFS image: Programming/Verifying 0xGzip read error yaffs_src[512+4]=yaffs_src[512+5]=oob_read failed, aborting Block ok at page 0xBlock bad (skipped) at page 0xWrite failed at sector 0xRead with ecc failed at sector 0xBad ecc sector 0xBad 1st ecc value 0xBad 2nd ecc value 0xNAND write Verify failure Sector is 0xOffset is 0xIndex 0xDownloaded 0xRead back 0xYAFFS partition programming Success Gzipped NAND images not yet supported Nand write failed Nand write succeeded addr: data: error while copying to flash! verifying ... Verifying NAND device nand: read failure nand: verify error at ram address 0xnand: offset 0xnand: ram value 0xnand: read value 0xnand: verified ok calculated crc32 = 0xdesired crc32 = 0xerror programming flash (crc check failed) error programming flash at offset= src= flash=not checking any more locations formatting ... done. load flashregion -- upload an image to the flash. dangerousflashregionCan't load to partition <> while running from ram. Operation canceled loading flash region using xmodem download error. aborting. img_size is not a multiple of 4 -- are we sure that's OK? load [partition] -- xmodem receive to flash partitionload params -- xmodem receive to flash partitionparamsError: no partition named Here are the defined partitions partition is a bootldr partition: requiring a bootldr or parrot image. is a jffs2 partition: expecting .jffs2 or wince_image.gz. is a kernel partition: probably expecting a zImage. After receiving file, will automatically uncompress .gz images bootldr:program program could not find flash partition programming flash partition ram src = len =usage: program save Could not find partition boot: nand chip not found nand_upload: Reading NAND partition nand upload: nand chip read failed nand upload: partition read ok BSD checksum is = 0xnand upload: About to xmodem send nand upload: xmodem error. nand upload: ok. About to xmodem send flashword= base= nbytes=download error. save all -- upload all of flash via xmodemallsave flash -- upload flash region via xmodemusage: save flash error parsing error parsing flash_dest=flash_size=save ram -- upload dram region via xmodemusage: save ram error parsing ram_dest=ram_size=peek ram -- reads 32 bitspeekpeek byte -- reads 8 bitsbytepeek short -- reads 16 bitsshortpeek int -- reads 32 bitsintpeek flash peek gpio gpiopeek ram requires arguments! error parsing addr addr = value = poke ram -- reads 32 bitspokepoke byte -- reads 8 bitspoke short -- reads 16 bitspoke int -- reads 32 bitspoke flash poke gpio poke ram requires arguments! error parsing value poke ram: addr= value=flash write failed! breakpoint [delayed] -- TODObreakpointdelayedPC breakpoint will be set after kernel unzip at: Setting hardware PC breakpoint at: Clearing PC breakpointqflash id | security | qflashqflash requires arguments! idsecurityvalue = eflash | [] | chipeflasheflash requires arguments: | []|chip! erasing partition chipCannot erase whole chip without setting override to 1. erasing flash chip error parsing addr: addr=error parsing len: len=Cannot erase first sector without setting override to 1. pflash 0|1 -- (1 -> protect, 0 -> unprotect all)pflashpflash requires arguments: 0/1 (1 -> protect, 0 -> unprotect all)! error parsing protect: error protect value must be 0/1: addr= len= protect=Region specified is out of Range. Please use a range less than:call [a0] [a1] [a2] [a3]calljump [a0] [a1] [a2] [a3]jumpusage: call [a0] [a1] [a2] [a3] last_ram_load_address is 0. error parsing vaddr Calling fcn= a0= a1= a2= a3=physaddr -- returns physical addressphysaddrphysaddr requires vaddr argument! vaddr=paddr=sectionDescriptor=invalid baud rate: Please, try: 110, 300, 1200, 2400, 4800, 9600 19200, 38400, 57600, 115200 or 230,400 update_baudrate: new baudrate= baudrate changed to 0xMMU Control word=cmdex [0|1] -- use extended commandscmdexuse_extended_getcmd=0xAutoboot is DISABLED ledblink [on time] [off time] [off = 0] -- blink the LEDledblinkttmode [1,0] -- go into ttmodettmodeser_con -- start a serial console sessionser_conirda_con irda_con -- start a irda console sessionirda_conirda not available yet, starting serial console. memcpy [size]memcpymemcpy needs args: dst src num [size] bad dst param bad src param bad num param bad size param memcpy src: 0xdst: 0xnum: 0xsize: 0xBad size: 0x| hex_dump [size]hex_dumpreset -- software resethalt -- power downhaltFeature not available on this hardware. addr1=0xaddr2=0xw1=0xw2=0xmemcmp [size]memcmpbad addr1 param bad addr2 param memcmp a1: 0xa2: 0xver -- display version infovermem -- show info about memorymemFlash memory info: SDRAM memory info: SDRAM size:SDRAM bank0: mdcnfg = 0x mdrefr = 0xmemtest -- test mem between addrsmemtestmemtest needs args: addr1 addr2 seed bad seed param bad fillval param store vals . cmp vals mismatch, want: 0x got: 0x addr: 0xmax_mismatches exceeded, aborting. cmp done *********num_mismatches 0xtestjffs2 testjffs2 -- TODOtestjffs2read which file??? bad dst param copy the file to where??? infojffs2 [partition_name]infojffs2timeflashread [partition_name]timeflashreadls [partition]ls/load file [partition] [filename] [dest] -- jffs2 read filecowerror parsing clearmem [num] [dst]clearmemcmpkernels [dst] [src] [len]cmpkernelswhich kernel partition? bad len param enable_caches [dcache] [icache]enable_cachesbad dcache param bad icache param asmEnableCaches = out of room to build params list! + pef [just_show]peflli -- low level coprocessor infolliARCH INFO(CPR0)=MMU Control (CPR1)=TRANSLATION TABLE BASE (CPR2)=DOMAIN ACCESS CTL (CPR3)=FAULT STATUS (CPR5)=FAULT ADDRESS (CPR6)=MMU PROC ID (CPR13)=BREAKPOINT (CPR14)=Program CounterC (PC)=cat [partname] -- show file from partitioncatcat what file? jffs2 read [partname] -- reads jffs2 file into dram at dstaddrreadwhat dstaddr? what file? Reading file: from jffs2 filesystem in partition: . Writing contents of file to address Number of bytes read is wrong magic: wrong arch: Not linked for flash, start_addr=Does not support this CPU, boot_caps=BSD checksum nonzero parrot word 0 ->0xExpected ->0xparrot word 0xFFC ->0xor ->0xparrot word 0x1000 ->0xExpected ->0xwince firmware 0 ->0xExpected ->0xfirmware word 0x40 ->0xfirmware word 0x1000 ->0xExpected ->0xYou must load wince BEFORE loading Parrot discover -- guess what machine I am; see mach_type for resultdiscovermach_type ->initialize_by_mach_type done tdz -- test decompress routines (best with ASCII) preflashingtdznot enough args, need error parsing address error parsing dAddress verify img = uncompr size = finished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xErasingEnd Detected Skipping Copy of Flash MBM29LV400TC_1x16MBM29LV650UE_1x16No flash descriptor: reset flashprogram flash worderase flash chiperase flash sectorerase flash rangeNo flash algorithm known for CFI vendorID=the flash sector needs to be erased first! flashAddress= flashWordOffset= flashContents= value=Upper bank of flash timed out!!Lower bank of flash timed out!!programFlashWord timeout value= oldFlashContents= &flashword[flashWordOffset]=eraseFlashChip timeout flashp=eraseFlashSector: sectorAddress must be start of a sector! address=nsectors=eraseFlashSector timeout timeout=Erasing sector amdFlashProtectRange: unimplemented!! Flash types supported (2x16): Flash types supported (1x16): Current flash type is Flash size: UNKNOWN! setting flash type= Unknown flash device type: for flash organization: 2x161x16Eek, no flash descriptor to munge root partition size set to 0xNo NAND get root partition failed assetbtflash_add_partition: could not allocate memory for partition table allocated partition_table defining partition: no partition table! no partition <> found partition <> deleted QRYNONE Flash style = verify flash size... verify flash size failed. Using fake CFI table for JEDEC chip <> No non-CFI chip detected. Ignoring fake CFI table. Resetting flash algorithm. re-verifying flash size... btflash_init: mfrid= devid=mfrid=deviceid=walking flash descriptors () btflash_init: found flash flashDescriptor= flashSectors= nsectors= flash_size= flash_address_mask=btflash_init: FAILED! Unknown flash type! protecting the bootldr flash_addr_shift(): bad bt_flash_organization=flash_make_val(): bad bt_flash_organization=flash_write_cmd(): bad bt_flash_organization=flash_read_val(): bad bt_flash_organization=flash_read_array(): bad bt_flash_organization=flash_write_val(): bad bt_flash_organization= ******** malloc out of storage ******** size=flash_iohandle_prewrite: unprotecting bootldr rc=eraseFlashRange returned rc=error while copying to flash! flash_open_iohandle: no partition named : out of memory jffs2_open_iohandlehda1:copy src dst [len] -- copy from src to dstcopyCould not open source Could not open destination destination does not support writing. srclen=dstlen=nbytes=command_copy: read failed err= addr: data: : write failed err=paramsbootldr:usage: copy srcspec = | | hda1: [] xmodem_initial_timeoutxmodem_timeoutxmodem_one_nakready for xmodem download.. startingRX PACKETTIMEOUTBAD BLOCK#BAD CHKSUMDONEABORTEDWRONG BLK Download Failed! Download Successful timeout nakgoto againboot [partition] -- boots off the specified/default partition (see boot_type param)bootwinceidevfatbooting ... kernel partition base kernel_magic=no boot image in flash kernel_region_words[9]=Linux ELF flash_imgstart= size= dest= offset= MMU Control=MMU PIDVAM=copying Linux kernel ... done Skipping kernel copy by request. : Copying compressed initrd from to ...Done root_filesystem_name=Grabbed linuxargs, argc = Using mach_type pre unparse setting boot parameters to setting boot parameters to linuxEntryPoint=Booting Linux image CP15 r0=CP15 r1=CP15 r2=CP15 r3=CP15 r5=CP15 r6=CP15 r13=CP15 r14=copying NetBSD kernel ... netbsd done! Jumping to 0xF0000020.. Unrecognized kernel image boot flash [partition]flashkpart=cannot find kernel partition named >< booting kernel from partition > nfsroot= ip=::eth0 initrdboot wince -- boots WinCEboot qnx -- boot QNX/NeutrinoqnxBooting QNX... dramFound a QNX kernel @ 0xERROR: No QNX IFS found - searched from 0xboot yaffs [partition_name] [boot_file] -- read kernel from yaffs file (see boot_file param)yaffsUnable to boot file <> Kernel filesize = 0xBooting file ""... boot addr
-- boots a kernel loaded in DRAMaddrnot enough args, need
error parsing img_dest error parsing img_size boot boot -- boots the bootloader, againMalfunctioned Failed BadPacket End of Text End of Session Timed Out Transmission Breakdown Buffer OverflowUnknown Error totalPackets= Transfer timed out Transfer canceled by reciever ackcnt=nakcnt=GOT a ACK GOT a NAK Transfer canceled - Maxuim error count exceeded Upload Successful Transfer may not have competed Bytes Transferred= impossible condition #876 Verifying gzipped image . verifyGZipImage: calculated CRC = 0xverifyGZipImage: read CRC = 0x1.1.4inflateInit2 failedinflate error :0xstream msg = calc crc32 is 0xread crc32 is 0xfinished loading with runningCRC = 0xuncompressed length = 0xtotal_in = 0xread_crc returns = 0xcrc32 static calc= 0xhelp [command] -- Displays help texthelp ?apropos -- searches for text in help descriptionsaproposapropos Trying to load help... you can't execute the cmd <> while running from ram Don't understand command RXSTAT error: MSG/ *0x == HEX_TO_ASCII_TABLE corrupted strtoul: leadingZero nchars=strtoul: base16 nchars=strtoul: base8 nchars=strtoul: c=baudrateautoselectosyaffsboot_typeboot:zImageyaffs_boot_filekernel_in_ramkernelautoboot_kernel_partforce_unzipnoeraseoverrideicache_enableddcache_enabledentryuse_initrdcopy_initrdinitrd_startinitrd_sizeinitrd_partitiondram0_sizedram1_sizedram_n_banksmemc_ctrl_reg noinitrd root=/dev/mtdblock1 init=/linuxrc console=ttySA0linuxargsmach_typerootkernel_partitionboot/initrdinitrd_filenameboot/zImagekernel_filenameptable_addrhostnamedomainnameipaddrgatewaynetmaskdns1dns2netcfgnfs_server_addressnfsrootverbosecmdexjffs2_sector_marker0jffs2_sector_marker1jffs2_sector_marker2/etc/bootldr.confconf_fileboot_vfat_partitionreflashrecb_cmdser_concalb_cmdusb autoinitconb_cmdboot vfatqb_cmdbootstartb_cmdupb_cmdrightb_cmdleftb_cmddownb_cmdaction_cmdsuppress_splashautoboot_timeout2.05boardtclbuildsplash_filenamesplash_partitionboot_flagsenable_mmuget_param: could not find parameter params_eval: prefix_in = params_eval: just_show =eval param blk found partition table in params sector pt->npartitions=partition_table_size=+params eval [-n] -- shows the parametersevalparamsbootldr:-nparams load [-n] -- loads parameters from fileloadboot:/boot.confyaffs read error bootldr: <> params -- displays the parametersparams reset -- sets the parameters to default valuesresetsetting params to default values flashword = bootldr_params = FLASH_BASE = sizeof(bootldr_params) = setting param <> to value <set_params_by_name 1 set =setshowshow params show -- show parameters>> = <=<=<0xparams save [-n] -- write params to partition, if existssaveflashword=0x&__params_begin=0xFLASH_BASE=0xdefaultParam=0xbootldr: set "0xNot erasing and writing params sector. no control function h3xxx genericgpio_init: unhandled mach_type=balloonPeripheral Power established balloon_init -- initialise balloon hardwareballoon_initconsole_linuxargs -- sets linuxargs to framebuffer consoleconsole_linuxargsset linuxargs="noinitrd root=/dev/mtdblock2 init=/linuxrc"debug_gpio -- set | clear | read | input | outputdebug_gpiosetusage: debug_gpio set clearusage: debug_gpio clear getGPLR =0xinputusage: debug_gpio input outputusage: debug_gpio output switchserial -- switches serial port argc times switchserialSwitching 0xid -- read the ID chip dataidMachine id: xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆuse_ptableuse_mtd_cmdlineyaffsrootfstypemdcnfg= rootfstype=cpufreq=59000-206400 machine_id=board=build=Making core tag at Making cmdline tag at Making mem32 tag at Making initrd tag at initrd.start= initrd.size=command line is: usb init -- starts usbinitusbusb status -- does a status check on USBstatususb sercon -- switches back to serial consoleserconusb deinit -- sets usb_initted to 0deinitusb loop -- does a 10sec poll looploopusb version -- prints USB codebase versionversionusb spit4 -- spits 4 letters outspit4usb spit8 -- spits 8 letters outspit8usb spit12 -- spits 12 letters outspit12usb spit16 -- spits 16 letters outspit16usb spit20 -- spits 20 letters outspit20usb console -- switches to console on USB.consoleusb autoinit -- auto-inits USBautoinitversion 1.0rc1 aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaPlease disconnect serial and connect USB to the device. After doing so, launch a console on /dev/usb/tts/0 andinput a character. .Now switching to console on USB... Now switching to console on USB... success!! Console is now over serial. WARNING: previous failure initting USB. things may fail again this time due to a weird state. eeps! usb already initted! things might be in a bad state, so we won't do it again, kk? interrupts must be enabled. failed to initialize interrupts timeout disabling UDC timeout enabling UDC timeout clearing 1 timeout clearing 2 timeout unmasking interrupts Couldn't set Ser0UDCOMPusb successfully enabled USB not initialized! run usbinit first! previous failure initting USB. run usbinit again to try again. doing a single poll. Ser0UDCSR: reset interrupt request resume interrupt request suspend interrupt request transmit interrupt request recv interrupt request ep0 interrupt request still sending something else!timed out waiting for send completeproceeding anywaycount == 0??MASSIVE ATTACK failed :(MASSIVE ATTACK worked :)timeout flipping tx statusignored interrupthmm, TIR, but not sendbusy >.<Too late, underrunTPETPC failureRFSRPE.timeout flipping rx statusSST.Code: Whisky Tango Foxtrot (could not clear SST)FST. We didn't set this, who did?eek, couldn't clear rpc!timeout blocking on IPR next reset state errortimeout flipping statustimeout clearing resetLUSB: LoopingU_USB: Done done next state is error!couldn't set resimcouldn't set susimsent stallEarly term of setupno OUT packet avail. exitingfifo READ ERROR, not enough bytes, Stalling out...PocketPC init sequence detected - starting DMA herekEvAddressSET_CONFIGURATIONbad time to config!kEvDeConfig errorsetup phase: unknown setconfig dataCLEAR_FEATclear feature ep halt on recvrclear feature ep halt on xmitrclear feature ep halt on bad epunsupported clearfeatureSET_FEATset feature ep halt on recvrtimeout setting 1 timeout setting 2 set feature ep halt on bad epbad setfeatureGET_STATUSunknown ep in getstatunknown tgt in GETSTATGET_DESCRGET_CONFIGgetint not supportedsetint not supportedunknown requestquitting setde b/c SST/SE setcan't set de (MEEP)can't set ipr (MEEP)quitting setiprde b/c SST/SEcan't set iprde (MEEP)clear_opr() failed ASSERTION FAIL, fifo_count > 8read_fifo: read failure :(write_fifo: write failure!the UDC most likely locked up. sorry.so didn't clear oprcheckz0r, 0 bytes leftqueue_and_start_write donesh_write(): IPR set, exitingsh_write empty() Sent empty packet write fifowrote fifoDESC_DEVICEDESC_CONFIGzerovendprodNULLunknown string indexIFEPunknown ep index, stall unknown desctype, stall wanted bytes we didn't haveint init -- starts interruptsinitintint version -- does a interrupt version checkversionint readcpsr -- read cpsrreadcpsrversion 0.3sa Interrupts are already running. Not reenabling. enabling interrupts: handler, stack, irq, unmask, done CPSR: dma init -- starts dmainitdmadma poll -- polls once on DMApolldma version -- does a dma version checkversionversion 0.9 DMA from buffer A is done! *ding!*DMA from buffer B is done, but there is no buffer B. *poof!*DMA error! *wh00nk*yes, it's running.no, it's not running.dma-sa1100.c: dma_startsend: timed out waiting for DCSR_RUN to become 0.memcpyoutUVY ZZ YVUe03f not found File read error program bootldr 0x 0xexec-ing bootrootnand yaffs root sm:/root-balloon-std.yaffs.gzsavenand yaffs save root sm:/sm:/root.saverestorenand yaffs root yaffs cp sm:/cramfs/.cramfs root:/usr/usr.local.cramfsusage: build [ base | std | bootldr | bootldr.fast | bootldr.slow | boot | root [filename] | (for usr.local.cramfs)] also: build save | resore [ filename ] - saves/restores root filesystem to file Generally production should do and then or some similar filename nand [command] -- Does NAND stuffnand01nocacheicachedcachebothcacheinitwaitinitwaitnand: nand_wait = 0xforce_erase**WARNING** Forcing NAND erase is a *BAD* practice! nand: cannot get NAND device chipsizenand chip: size = 0xerasesizenand chip: erasesize = 0xscanblocksnand scanblocks: Scanning all blocks for bad block data Bad block. sector 0xscanblocks passed 0xscanblocks failed 0xmarkbadblocknand markbadblock: needs block number Block already marked as bad nand markblock: Marking bad block 0xBlock successfully marked bad Bad block mark is 0xmarkbadsectorSector successfully marked bad checkblocksnand checkblocks: Checking all blocks for bad block data Firstblock must be positive Lastblock is past the end of the device Lastblock is less than firstblock Checking blocks from to inclusive Skipping bad block 0xChecking block % Erase bad block failed block 0xWrite failed at sector 0xPage read failed at sector 0xaarrgh!! Verify error at address 0xcheckblocks completed scansectorsnand scansectors: Scanning all sectors for bad sector data scansectors passed 0xscansectors failed 0xerasechipnand erasechip: Erasing entire chip nand erasechip: erase failed verifyVerifying erase of all sectors Skipping bad block at sector 0xUnexpected bad block mark error in oob of sector 0xError in oob of sector 0xError in data of sector 0xnand erasechip: sector verify failures 0x0nand erasechip: passed eraseblocksnand eraseblocks: Erasing blocks Bad erase of block 0xtestNo sectors specified! nand test: Erasing 0xnand test: Actually Erasing 0xnand: erase failed Hello World.This is some news.nand test: writing sectors ... 0xnand test: writing failed at sector 0xnand test: written 0xnand test: reading sectors ... 0xnand test: read failed at sector 0xnand test: error index 0xnand test: read 0xnand test: passed readnand: Reading 0xfailed! Ok nand : data 0xwritenand: Programming data from address 0xnand: write failed - verifying anyway. band: write verify read failed nand: verify failed atnand: written data nand: read data nand: write verified read_all_eccNot a NAND partition nand: Reading sectors count=0xnand: Read ecc failed sector = 0xSector read ecc1 failed, sector = 0x ecc1 = 0xSector read ecc2 failed, sector = 0x ecc2 = 0xErrors = 0xread_eccnand: Reading data with ecc from address 0xnand : spare 0xnand: eccres1 = 0xnand: eccres2 = 0xread_oobnand: Reading spare from address 0xnand: Read spare failed write_oobnand: Writing oob 0xwrite_eccnand: Writing ecc 0xnand : oob 0xnand: write failed - verifying nand: verify read failed nand: oob verify failed atnand: oob written data nand: read oob data erasenand: Erasing from address 0xyaffsgzipCannot find partition <> nand read error Image size = 0xWrite failed to file <> result = 0xWritten ok Sending yaffs fs image Start your xmodem upload now ... download error. File size is zero. Nothing to save Can't load yaffs image while running from ram. Operation canceled loading yaffs image Opening <> Reading file length 0xYaffs read failure Cannot open file using xmodem download error. aborting. Looks like a gzipped image, verifying ... Invalid gzip image. Gzip image detected and verified Filesize must be multiple of 512+16 for yaffs partition erasing ... Erasing NAND region Erasing from 0xErasing bytes 0xnand: erase ok nand_yaffsimage: Programming/Verifying 0xGzip read error pageStatus =Correcting bad blockStatus =oob_read failed, aborting Block ok at page 0xBlock bad (skipped) at page 0xNAND write Verify failure Sector is 0xOffset is 0xIndex 0xDownloaded 0xRead back 0xYAFFS partition programming Success nand command <> unknown bootsmsmartmedia1Unknown partition <> Partition <> is not yaffs Nand device not found YAFFS Guts Initialise *FAIL* YAFFS Guts Initialised .../*** error *** : -> Free bytes = 0xDirectory not found Cannot delete existing file (but I may be lying) Deleted <Cannot create file Cannot write file yaffs [command] -- reset ls cat rm and writeyaffsyaffs ls | cat | rm | write path resetlscatInvalid filename Not a normal file Error reading file Must supply filename readFile read error File read ok File size is zero, nothing to send. Sending file size = 0xusing xmodem Filename not supplied writedownload error. aborting. File write error File created ok cpReading file <> length 0xWriting file <Error writing file Ok Cannot open <Filenames not supplied rmDelete failed File deleted Command <> not known $Id: yaffs_guts.c,v 1.26 2003/05/20 23:20:53 charles Exp $lost+foundobj_TOOBIGobj$Id: yaffs_mtdif.c,v 1.1 2003/04/08 13:24:16 jamey Exp $nandmtd_WriteChunkToNAND: at block mark, writing 0x $Id: yaffs_ecc.c,v 1.2 2003/05/20 23:20:53 charles Exp $UY e0jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code001lD1pl1t1|11111111111242L2t222223$3@322`333333333x44 5$ (<5,5@5L5P5,tX5`5h5t777(747@7d777778,848\8,|88888888899$949@9P9999@9999: : :x4:D:`:,p:4|::0D:;;|;;;p<<=<=0=p= ======= > >4>>>>>8?T?p????? @@@`@@@@@@@ A$A4AHAdAAAAA8B$BXBtBBBBBBCC(C8CHCpCCCCCCDDDDDlEBC$D?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~yy~\~ly}}\~ltb" Lbootldrboot`root`b"|bootldrboot`root`TQRY@'6 PRI11\xؚ̜H0Lh D0Lh D̀../0="handhelds.org"handhelds.org opensource bootldrdܘk Ș  s@u@pv@Xy@Dd0k    s@̗u@v@y@s@ $Thu Nov 6 11:02:59 GMT 2003 `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`??m,m >*H>>4?+ ?>E*E>9F>G9FH:hH6$<,I6J>J6>`>J64?d?KLL4?t@(LLLxLt@TLLLLt@LLLLt@LLL>t@LLLLt@LM4? BTMMxL BMML BMML BMM> BNML B$NN(DNxODXOOFOXQHQpRxJPRRxJxRdSTL4ST0OT4U(PTdU$QDUUQlUU RU4VRVWVV6WWp<$aZ`[@bH[[bl[[ d[t\hd\\Hhx\]